close

SimulationCraft 406-19

for World of Warcraft 4.0.6 Live (build level 13623)

Table of Contents

Raid Summary

DPS Chart DPS Chart Gear Chart Gear Chart Timeline Distribution Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Death_Knight_Unholy_1h_T11_372 : 23454dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
23453.6 12.65 / 0.05% 3486.9 6.7 6.8 runic_power 19.41% 50.6
Origin http://chardev.org/?profile=34574
Talents http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
Glyphs
  • horn_of_winter
  • raise_dead
  • death_and_decay
  • death_coil

Charts

http://9.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:53632|14414|9974|9480|6400|6390|5987|5936|2360|2106|1312|830&chds=0,107264&chco=9482C9,9482C9,336600,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++53632++death_and_decay,9482C9,0,0,15|t++14414++death_coil,9482C9,1,0,15|t++9974++gargoyle_strike,336600,2,0,15|t++9480++festering_strike,C79C6E,3,0,15|t++6400++scourge_strike,C79C6E,4,0,15|t++6390++sweeping_claws,C79C6E,5,0,15|t++5987++plague_strike,C79C6E,6,0,15|t++5936++icy_touch,2459FF,7,0,15|t++2360++melee,C79C6E,8,0,15|t++2106++melee_main_hand,C79C6E,9,0,15|t++1312++melee_off_hand,C79C6E,10,0,15|t++830++melee,C79C6E,11,0,15&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:16,10,10,9,9,8,7,6,6,5,5,4,4,2,0,0,0,0&chds=0,100&chco=9482C9,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,9482C9,C79C6E,336600,C79C6E,2459FF,C79C6E,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|melee|sweeping_claws|scourge_strike|melee_main_hand|scourge_strike_shadow|death_and_decay|blood_plague|melee_off_hand|gargoyle_strike|claw|frost_fever|festering_strike|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:RdrMFQdnvxwz574355444335787665431zyxwvwwwvusqonnmlkjihhgffedccbbaZZZZZYYYXXXXXWWWWWVVVVVVUUUVVVVVVUVUUUVVVVVUUUVVUVVVVVVVWWVVVVVWVVWWVVVVVVVVVVUVVUVUUUUUUUUVVUUUUVVVVVVVUVVVVVVVVVVWWXXVVVVVVVVVVVVVWWWWWWWWWXXXXXXWWVVVVUUUVVUVUUVVUVVVVVVVWVVVVWWVVWVVVVVVVVVVVVVVVVVVVVVUUUUVUUUVVUUUVVUVVVVVVVVVVVVVVVVVVVVVVXZaccddcccccbbaaaaZZZYYYYXXXYYYZZZaaaabbcdefggggggffeedcbbaaaaaZZZZZYYYYYYYXXXXXXXXYXYYXXXWWVVVVVVVVVVVVVVVVVUVVVVVUVVVVUVVVVVUVVUUVVVVVVVVVVVVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=76&chtt=Death_Knight_Unholy_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uwyyz011222456877765420zxwvtsqppnmlkjihhgfgffeddccbbaaZZZYYYYYYYZZZZZZZaaaaaaaaaZZZYYYYXXXXXXXXXXXYYYYYYZZZZZZaaaaaabbbbbbbbcccccdcddddddccccbbaaaZZYYXXXXWWWWWWWWWWXXXXXYYYYZZZZZZaaaabbbcccddeeffffggghhhhhgggfffffeeddddccccccccddddddddcdccccbbbaaaaZZZZZZZYZYZYYZYZYZYYYYYYYYYYYXXXXXXXXXXYYYYYYYYYZZZZZZZZZZZZZZZZZZZZZaaaabbbbcccccddddddddddddddccccccccccccccccddddddeeeeeffffffgggggggggggggggfffeeedddccbbaaaaZZZZZZZZZZZZaaaaaaabbbbbbbbbbbbbbbbbbaabaab&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=23454|max=48425&chxp=1,1,48,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,1,3,12,11,25,32,54,68,94,127,186,241,274,338,410,468,518,543,590,569,594,591,601,525,502,472,403,345,322,232,217,152,149,108,65,53,30,35,15,11,5,4,0,0,0,0,0,1&chds=0,601&chbh=5&chxt=x&chxl=0:|min=21267|avg=23454|max=26130&chxp=0,1,45,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_1h_T11_372 23454
blood_plague 1414 6.0% 7.2 67.39sec 89227 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3634 7598 15.7% 0.0% 99.6%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.17 7.17 150.25 150.25 0.0000 3.0000 639381
Direct Results Count Pct Average Min Max Total Damage
hit 7.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.7 84.33% 3634.44 2900 5300 460489
crit 23.5 15.67% 7598.14 6061 11077 178892

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 3.0 77.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.0 50.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.96 8.96 0.00 0.00 1.0161 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.0 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:60.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1750 7.5% 14.5 32.22sec 54545 53632 0 0 0 15.7% 0.0% 0.0% 0.0% 243 2788 5827 15.6% 0.0% 50.4%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.51 14.51 242.54 242.54 1.0170 0.9402 791463
Direct Results Count Pct Average Min Max Total Damage
hit 12.2 84.31% 0.00 0 0 0
crit 2.3 15.69% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 204.6 84.36% 2787.77 2272 4141 570382
crit 37.9 15.64% 5826.79 4749 8654 221081

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:16
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3660 15.6% 114.0 3.92sec 14521 14414 11854 24765 34578 20.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.02 114.02 0.00 0.00 1.0074 0.0000 1655690
Direct Results Count Pct Average Min Max Total Damage
hit 90.5 79.34% 11853.69 9830 16544 1072425
crit 23.6 20.66% 24765.19 20546 34578 583265

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 302.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 917 3.9% 43.1 10.52sec 9614 9480 8646 17800 23285 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.14 43.14 0.00 0.00 1.0142 0.0000 414777
Direct Results Count Pct Average Min Max Total Damage
hit 38.6 89.43% 8646.46 7462 11303 333586
crit 4.6 10.57% 17799.61 15372 23285 81191

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $s2% weapon damage plus ${$m1*$m2/100} and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 1004 4.3% 8.7 54.21sec 52340 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2579 5388 15.7% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.68 8.68 150.31 150.31 0.0000 3.0000 454161
Direct Results Count Pct Average Min Max Total Damage
hit 8.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.6 84.25% 2579.28 2055 3767 326645
crit 23.7 15.75% 5388.16 4295 7874 127517

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 36 0.2% 2.7 109.89sec 6023 5936 5151 10756 15113 15.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.74 2.74 0.00 0.00 1.0147 0.0000 16488
Direct Results Count Pct Average Min Max Total Damage
hit 2.3 84.43% 5150.50 4435 7526 11903
crit 0.4 15.57% 10756.19 9034 15113 4584

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2103 9.0% 263.2 1.72sec 3614 2106 4045 8334 11234 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
263.23 263.23 0.00 0.00 1.7158 0.0000 951301
Direct Results Count Pct Average Min Max Total Damage
hit 130.1 49.44% 4044.57 3414 5454 526311
crit 28.0 10.65% 8333.89 7033 11234 233572
glance 63.1 23.97% 3033.61 2560 4090 191417
miss 42.0 15.95% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1310 5.6% 262.4 1.72sec 2259 1312 2527 5204 7021 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.43 262.43 0.00 0.00 1.7210 0.0000 592740
Direct Results Count Pct Average Min Max Total Damage
hit 129.9 49.52% 2526.53 2134 3408 328307
crit 27.9 10.63% 5203.65 4395 7021 145192
glance 62.9 23.98% 1895.03 1600 2556 119242
miss 41.7 15.87% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.9 82.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.94 5.94 0.00 0.00 1.0162 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 17 0.1% 1.2 134.19sec 6107 5987 5488 11292 14741 10.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.23 1.23 0.00 0.00 1.0201 0.0000 7488
Direct Results Count Pct Average Min Max Total Damage
hit 1.1 89.33% 5488.13 4920 7391 6011
crit 0.1 10.67% 11292.15 10136 14741 1477

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 2153 9.2% 150.1 2.99sec 6487 6400 5831 12015 15662 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.11 150.11 0.00 0.00 1.0135 0.0000 973690
Direct Results Count Pct Average Min Max Total Damage
hit 134.2 89.40% 5830.98 5042 7603 782478
crit 15.9 10.60% 12015.48 10387 15662 191212

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus ${$m1*$m2/100}. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 1760 7.5% 150.1 2.99sec 5304 0 5304 0 12806 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.11 150.11 0.00 0.00 0.0000 0.0000 796113
Direct Results Count Pct Average Min Max Total Damage
hit 150.1 100.00% 5303.63 3665 12806 796113

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:5393.26
  • base_dd_max:5393.26
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.3 220.48sec 0 0 0 0 0 15.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.29 2.29 0.00 0.00 1.0054 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 1.9 84.11% 0.00 0 0 0
crit 0.4 15.89% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 359 1.5% 114.0 3.92sec 1426 0 0 0 0 0.0% 0.0% 0.0% 0.0% 407 399 0 0.0% 0.0% 90.0%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.02 114.02 407.19 407.19 0.0000 1.0000 162571
Direct Results Count Pct Average Min Max Total Damage
hit 114.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 407.2 100.00% 399.25 101 1334 162571

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:228.01
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1411
claw 605 42.9% 13.0 2.86sec 1629 0 1491 2983 2983 9.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21183
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.75% 1491.43 1491 1491 17594
crit 1.2 9.25% 2982.86 2983 2983 3589

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 806 57.1% 23.0 1.48sec 1226 830 1189 2379 2379 9.1% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 1.4776 0.0000 28204
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 66.94% 1189.27 1189 1189 18310
crit 2.1 9.10% 2378.55 2379 2379 4979
glance 5.5 23.96% 891.95 892 892 4916

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1752
gargoyle_strike 1752 100.0% 48.4 6.47sec 11241 9974 11241 0 16064 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.35 48.35 0.00 0.00 1.1271 0.0000 543570
Direct Results Count Pct Average Min Max Total Damage
hit 48.4 100.00% 11241.33 8754 16064 543570

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 5659
claw 1060 18.7% 117.4 3.81sec 4088 0 3743 7487 11262 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
117.36 117.36 0.00 0.00 0.0000 0.0000 479729
Direct Results Count Pct Average Min Max Total Damage
hit 106.5 90.79% 3742.75 2746 5631 398789
crit 10.8 9.21% 7486.97 5492 11262 80940

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2357 41.7% 341.1 1.33sec 3126 2360 3029 6059 9221 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
341.05 341.05 0.00 0.00 1.3248 0.0000 1066247
Direct Results Count Pct Average Min Max Total Damage
hit 228.0 66.84% 3029.29 1861 4611 690544
crit 31.3 9.19% 6059.25 3722 9221 189948
glance 81.7 23.97% 2272.27 1396 3458 185755

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2242 39.6% 153.0 2.79sec 6627 6390 6069 12146 16633 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
153.02 153.02 0.00 0.00 1.0370 0.0000 1014002
Direct Results Count Pct Average Min Max Total Damage
hit 139.0 90.82% 6068.53 5273 8316 843357
crit 14.0 9.18% 12146.20 10545 16633 170644

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_1h_T11_372
death_coil runic_power 95.5% 570.0 25
summon_gargoyle runic_power 4.5% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 43.4% 102.2 40
sweeping_claws energy 56.6% 165.7 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 180.4 0.1 0.3%
horn_of_winter runic_power 17.9 179.1 10.0 0.0%
rune_abilities runic_power 223.7 2711.3 12.1 0.3%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 430.7 3.1 0.0%
pet - ghoul energy
energy_regen energy 1809.6 10736.7 5.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.4sec 120.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.3 0.0 57.5sec 57.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.0 0.0 50.8sec 50.8sec 57% 57%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 107.1sec 107.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.4 45.8 49.2sec 8.1sec 84% 83%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 43.9 0.0 10.1sec 10.1sec 34% 34%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.3 38.5 50.4sec 9.3sec 36% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 28.6 0.2 15.5sec 15.3sec 4% 4%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 79.5 282.4sec 5.5sec 98% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.3 48.4 220.3sec 6.2sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.60%
σ of the average dps 6.3259
2 * σ / μ 0.0539%
95% Confidence Intervall ( μ ± 2σ ) ( 23441.00 - 23466.30 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 23434.67 - 23472.63 )
Sample Data
σ 632.5943
Minimum 21266.94
Maximum 26129.75
Spread ( max - min ) 4862.81
Range ( max - min ) / 2 2431.40
Range% 10.37
10th Percentile 22678.77
90th Percentile 24312.81
( 90th Percentile - 10th Percentile ) 1634.04
Approx. Iterations needed for
1% dps error 29
0.1% dps error 2909
0.1 scale factor error with delta=300 3557
0.05 scale factor error with delta=300 14228
0.01 scale factor error with delta=300 355711
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILENPPLNP5JPPPMNPPQMDMPPQMPRPPPOQMRTKLPMPPRPPPRRPQRUPQRPPPROPPRPQNRUDQRRPPPRPPPRPBARUROQRPQPRPPNPRPPRUPQRDQPRPRPROPP5RNPQRUPQRPPRPPNPPRPUQROQRPPRPPRSDBAPRUPQRR9PQPPPGOPPRUPQRPQRPPPRPPPRUPQROQRDPPRNPPPNAPRQNRPQR5UPPPROPPNRPRQRUPQRDPPRPPPRPQRUORQPPPRRPPPRPQRRPQNRPPPRRADPORPUQRPTKLPMPPRRPPPPRQRUPQR9OPPRPPP5RUPQRPQRDPPRPPPRCAQROQRUPPPRPPPRPQRRPQRUPPPRONDPRRPQRRUPQRPPPRPPPROQRURPQRPPBAPPPRURDQR7OQ5RPPPRUPNPPPNQRRPQRRPPPRUOPPRRCBRDQRP9QUPR

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7000 5632 4914
Agility 721 138 20
Stamina 7621 6000 5825
Intellect 55 53 20
Spirit 85 85 20
Health 149663 127025 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.48% 18.48% 971
Spell Crit 12.45% 7.45% 1336
Spell Haste 12.35% 7.00% 896
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16794 12394 190
Melee Hit 11.08% 11.08% 971
Melee Crit 15.41% 8.02% 1336
Melee Haste 23.05% 7.00% 896
Expertise 27.04 27.04 812
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.08% 16.08% 1448

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 2
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 1
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 0
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_1h_T11_372
origin="http://chardev.org/?profile=34574"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
glyphs=horn_of_winter/raise_dead/death_and_decay/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
# Gear Summary # gear_strength=4914
# gear_agility=20
# gear_stamina=5825
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=812
# gear_hit_rating=971
# gear_crit_rating=1336
# gear_haste_rating=896
# gear_mastery_rating=1448
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_2h_T11_372 : 26803dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26803.3 13.69 / 0.05% 3717.8 7.2 7.3 runic_power 11.11% 55.5
Origin http://chardev.org/?profile=87453
Talents http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
Glyphs
  • blood_boil
  • pestilence
  • antimagic_shell
  • horn_of_winter
  • blood_tap
  • raise_ally
  • scourge_strike
  • raise_dead
  • death_coil

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:36077|13582|13346|10398|8978|8602|6435|5827|2798|2610|913&chds=0,72153&chco=9482C9,9482C9,C79C6E,336600,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E&chm=t++36077++death_and_decay,9482C9,0,0,15|t++13582++death_coil,9482C9,1,0,15|t++13346++festering_strike,C79C6E,2,0,15|t++10398++gargoyle_strike,336600,3,0,15|t++8978++scourge_strike,C79C6E,4,0,15|t++8602++plague_strike,C79C6E,5,0,15|t++6435++sweeping_claws,C79C6E,6,0,15|t++5827++icy_touch,2459FF,7,0,15|t++2798++melee_main_hand,C79C6E,8,0,15|t++2610++melee,C79C6E,9,0,15|t++913++melee,C79C6E,10,0,15&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:14,13,13,10,10,9,6,5,5,4,4,4,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,9482C9,9482C9,C79C6E,2459FF,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|scourge_strike_shadow|scourge_strike|melee_main_hand|melee|sweeping_claws|gargoyle_strike|festering_strike|blood_plague|death_and_decay|claw|frost_fever|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:QcpMENWemnqv23223324544577766765332110000zyxwutttsrrrrrqqqpponnmmlkkjjiiihgggfeedddcccbbbaaaaaZZZZZZZZZYYZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXYXYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYZZWWWWWWWXXXYYZZaabbccdddeeefffedcbbbaaZZZZYYYYYYYYXXXXYXXXXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXXXXXXXYYXXXXYYXXXXYYYYYYYYYYYYZYYYYYYYYYZYYYYYZZZZZZaaabcdeefghijjkllmllklkkjjihhhhhhhghhhhhhhhiiiiiiiiihgfeedddccbbbaaaaZZZZZZYZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=80&chtt=Death_Knight_Unholy_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:vwyzz0011113567778755310zyxwvutsqponlljiihhhhggffeeddcccbccbcbccccccccccdddddddddcccbbbbabaaaaaaaaaaZZZZaaaaaaaabbbbbcccdddeeeffffffffffffffeedddccbbaaaZaZZZZZZZZZaZaaaaaaabbbbbbccccdddeeffgghhiijjjkkkkkkkjkjjjiihhhhggggfffffffffffffffeeeeddddcccccbbbbbbbbbbbbbbbbcccbbbbbbbbbbaaaaaabaaaabaaaaaaaaaaaaaaaaaZZZaaaaaaabbbbbcccccdddddddddddddddddddddddddeeeefffggghhhiiijjjkkllmmnnnooooooonnnmmmlkkjjihggffeedddccccccccccccccccccccccccccbbbbbbcbbbbcbbcbcc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26803|max=50999&chxp=1,1,53,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,2,2,2,9,17,24,39,47,63,99,150,142,208,226,273,357,357,458,494,527,552,564,586,555,511,542,515,442,427,333,298,242,234,166,142,109,79,60,42,35,21,17,13,9,3,1,4&chds=0,586&chbh=5&chxt=x&chxl=0:|min=24286|avg=26803|max=29237&chxp=0,1,51,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_2h_T11_372 26803
blood_plague 1332 5.0% 6.3 77.30sec 95668 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3518 7356 12.7% 0.0% 99.7%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.30 6.30 150.34 150.34 0.0000 3.0000 602323
Direct Results Count Pct Average Min Max Total Damage
hit 6.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.2 87.27% 3517.82 2817 5142 461549
crit 19.1 12.73% 7356.21 5888 10746 140774

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 2.1 110.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.08 2.08 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.4 48.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.44 9.44 0.00 0.00 1.0120 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.4 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:60.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1185 4.4% 14.7 31.86sec 36537 36077 0 0 0 12.8% 0.0% 0.0% 0.0% 174 2704 5654 12.8% 0.0% 35.2%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.67 14.67 173.96 173.96 1.0128 0.9157 536006
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 87.19% 0.00 0 0 0
crit 1.9 12.81% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.7 87.22% 2704.09 2208 4017 410269
crit 22.2 12.78% 5654.49 4614 8395 125738

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:11
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3846 14.3% 127.2 3.52sec 13673 13582 11458 23958 33535 17.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.22 127.22 0.00 0.00 1.0067 0.0000 1739429
Direct Results Count Pct Average Min Max Total Damage
hit 104.7 82.28% 11457.91 9543 16045 1199407
crit 22.5 17.72% 23957.74 19946 33535 540022

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.97 1.97 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 1451 5.4% 48.6 9.32sec 13499 13346 12790 26356 33998 7.6% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.62 48.62 0.00 0.00 1.0115 0.0000 656288
Direct Results Count Pct Average Min Max Total Damage
hit 43.7 89.95% 12789.91 11218 16504 559306
crit 3.7 7.57% 26355.87 23109 33998 96982
dodge 1.2 2.48% 0.00 0 0 0

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $s2% weapon damage plus ${$m1*$m2/100} and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 977 3.6% 8.4 55.55sec 52645 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5396 12.7% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.39 8.39 150.35 150.35 0.0000 3.0000 441791
Direct Results Count Pct Average Min Max Total Damage
hit 8.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.2 87.27% 2580.10 2064 3777 338537
crit 19.1 12.73% 5395.68 4313 7894 103254

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 35 0.1% 2.7 115.47sec 5892 5827 5179 10809 15768 12.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.72 2.72 0.00 0.00 1.0111 0.0000 16020
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.34% 5179.20 4338 7545 12300
crit 0.3 12.66% 10808.92 9302 15768 3720

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2792 10.4% 197.0 2.30sec 6411 2798 6430 13246 17541 7.7% 2.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
196.97 196.97 0.00 0.00 2.2914 0.0000 1262720
Direct Results Count Pct Average Min Max Total Damage
hit 129.6 65.80% 6430.37 5531 8515 833446
crit 15.2 7.71% 13246.41 11394 17541 201082
glance 47.3 24.02% 4822.64 4148 6386 228192
dodge 4.9 2.47% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.7 87.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.67 5.67 0.00 0.00 1.0137 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 12 0.0% 0.6 150.90sec 8746 8602 8237 17085 22368 7.6% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.64 0.64 0.00 0.00 1.0167 0.0000 5560
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 90.42% 8236.94 7458 10858 4735
crit 0.0 7.60% 17085.21 15364 22368 825
dodge 0.0 1.98% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 3454 12.9% 172.2 2.60sec 9071 8978 8598 17714 22804 7.5% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
172.19 172.19 0.00 0.00 1.0104 0.0000 1562033
Direct Results Count Pct Average Min Max Total Damage
hit 155.0 90.02% 8598.35 7546 11070 1332791
crit 12.9 7.52% 17714.23 15545 22804 229242
dodge 4.2 2.47% 0.00 0 0 0

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus ${$m1*$m2/100}. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 3552 13.3% 167.9 2.67sec 9565 0 9565 0 23453 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.95 167.95 0.00 0.00 0.0000 0.0000 1606460
Direct Results Count Pct Average Min Max Total Damage
hit 167.9 100.00% 9565.31 7760 23453 1606460

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:7446.33
  • base_dd_max:7446.33
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.8 196.40sec 0 0 0 0 0 12.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 1.0055 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.16% 0.00 0 0 0
crit 0.4 12.84% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 377 1.4% 127.2 3.52sec 1341 0 0 0 0 0.0% 0.0% 0.0% 0.0% 411 415 0 0.0% 0.0% 90.8%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.22 127.22 410.65 410.65 0.0000 1.0000 170615
Direct Results Count Pct Average Min Max Total Damage
hit 127.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 410.6 100.00% 415.48 98 1256 170615

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:277.57
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1563
claw 652 41.7% 14.0 2.62sec 1630 0 1491 2983 2983 9.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 0.0000 0.0000 22820
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 90.71% 1491.43 1491 1491 18940
crit 1.3 9.29% 2982.86 2983 2983 3881

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 911 58.3% 26.0 1.34sec 1226 913 1189 2379 2379 9.1% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.00 26.00 0.00 0.00 1.3426 0.0000 31885
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 66.86% 1189.27 1189 1189 20673
crit 2.4 9.12% 2378.55 2379 2379 5642
glance 6.2 24.02% 891.95 892 892 5571

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1868
gargoyle_strike 1868 100.0% 62.5 5.93sec 11006 10398 11006 0 16107 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.54 62.54 0.00 0.00 1.0585 0.0000 688298
Direct Results Count Pct Average Min Max Total Damage
hit 62.5 100.00% 11006.44 8704 16107 688298

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 6144
claw 1036 16.9% 115.4 3.86sec 4060 0 3717 7436 11289 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
115.42 115.42 0.00 0.00 0.0000 0.0000 468559
Direct Results Count Pct Average Min Max Total Damage
hit 104.8 90.80% 3717.21 2755 5645 389556
crit 10.6 9.20% 7436.19 5511 11289 79003

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2607 42.4% 373.3 1.21sec 3159 2610 3061 6118 9243 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
373.33 373.33 0.00 0.00 1.2105 0.0000 1179424
Direct Results Count Pct Average Min Max Total Damage
hit 249.5 66.83% 3061.25 1867 4622 763802
crit 34.4 9.21% 6117.82 3734 9243 210287
glance 89.5 23.96% 2295.45 1400 3466 205335

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2501 40.7% 169.6 2.52sec 6672 6435 6111 12218 16673 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
169.56 169.56 0.00 0.00 1.0369 0.0000 1131310
Direct Results Count Pct Average Min Max Total Damage
hit 154.0 90.80% 6110.51 5291 8337 940780
crit 15.6 9.20% 12218.18 10581 16673 190529

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_2h_T11_372
death_coil runic_power 94.9% 562.0 24
summon_gargoyle runic_power 5.1% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.8 40
pet - ghoul
claw energy 40.5% 101.5 40
sweeping_claws energy 59.5% 166.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 179.7 0.1 0.7%
horn_of_winter runic_power 15.0 150.1 10.0 0.0%
rune_abilities runic_power 245.8 2966.3 12.1 0.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 474.0 3.4 0.0%
pet - ghoul energy
energy_regen energy 1809.6 11320.4 6.3 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 7.7 0.0 61.2sec 61.2sec 25% 25%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.4 0.0 48.2sec 48.2sec 61% 61%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.5 0.0 111.0sec 111.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.7 42.1 47.6sec 8.6sec 82% 82%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 47.8 0.0 9.3sec 9.3sec 38% 38%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.8 40.4 48.1sec 8.8sec 34% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 36.2 0.3 12.3sec 12.2sec 6% 6%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 88.8 259.9sec 5.0sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.8 62.5 195.8sec 5.7sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.83%
σ of the average dps 6.8446
2 * σ / μ 0.0511%
95% Confidence Intervall ( μ ± 2σ ) ( 26789.59 - 26816.97 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26782.75 - 26823.81 )
Sample Data
σ 684.4612
Minimum 24286.50
Maximum 29237.49
Spread ( max - min ) 4951.00
Range ( max - min ) / 2 2475.50
Range% 9.24
10th Percentile 25957.45
90th Percentile 27726.04
( 90th Percentile - 10th Percentile ) 1768.59
Approx. Iterations needed for
1% dps error 26
0.1% dps error 2608
0.1 scale factor error with delta=300 4164
0.05 scale factor error with delta=300 16657
0.01 scale factor error with delta=300 416432
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQPPPR5PNLPPPMPNPPMDPRPRQPLQNORRPPPRTKLNPPMPNPPPMNPPNQMMPPPMONDQMPQMPPPMPPPMPQNRQPRRPPPRNPOPPQRRQPRUPPPRBAPPRQDNRQPRUOPPRPP5PRPQRPQNPPPRNPPPRRURPQRQONRDPPRPPPRRQPRUQPR9PPPROPPRAUQPRQPRPNPPPGNDPPQPRUROPQRPPRPPPRQPUPQRNPPPRPPPNRQD5RROQPRPPNPPPPNPPRRQPRQPPPPPPPRRPBANOPQRRDQNPPNPNPPPMNRPQRQPRPPPRUOPPPRQPRQPRPRPPPRPPUTKLPMQRDOPRRRPPPPPQRRU9PQRPPP5RPPPRAOPLQRRPPKPJPPGPPURQNPRQDNPPPRPRSOPRPPRUQRPNQPRPPPRPPUPRQRONQRDPRPPRPSPPRANPQRPNUQPRPRPORPPPRQRPQRPR7PPP5RDURPPQROQRNPPPUPRPPPRPNBARPRQRUOQRD9PPRPPPR

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7032 5662 4942
Agility 721 138 20
Stamina 7661 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150223 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.59% 18.59% 982
Spell Crit 9.56% 4.56% 818
Spell Haste 23.65% 17.76% 2274
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16866 12455 190
Melee Hit 8.18% 8.18% 982
Melee Crit 12.52% 5.13% 818
Melee Haste 35.42% 17.76% 2274
Expertise 16.12 16.12 484
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.26% 14.26% 1123

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 1
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 0
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 1
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 3
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 1
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_2h_T11_372
origin="http://chardev.org/?profile=87453"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
glyphs=blood_boil/pestilence/antimagic_shell/horn_of_winter/blood_tap/raise_ally/scourge_strike/raise_dead/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs=sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
# Gear Summary # gear_strength=4942
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=484
# gear_hit_rating=982
# gear_crit_rating=818
# gear_haste_rating=2274
# gear_mastery_rating=1123
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_1h_T11_372 : 26126dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26125.6 11.83 / 0.05% 2913.3 9.0 9.1 runic_power 0.84% 47.4
Origin http://chardev.org/?profile=75143
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:17242|16998|10134|4480|3607|2695|1802|1681|757&chds=0,34485&chco=2459FF,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++17242++howling_blast,2459FF,0,0,15|t++16998++obliterate,C79C6E,1,0,15|t++10134++frost_strike,2459FF,2,0,15|t++4480++blood_strike,C79C6E,3,0,15|t++3607++plague_strike,C79C6E,4,0,15|t++2695++melee_main_hand,C79C6E,5,0,15|t++1802++melee,C79C6E,6,0,15|t++1681++melee_off_hand,C79C6E,7,0,15|t++757++melee,C79C6E,8,0,15&chtt=Death_Knight_Frost_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:17,15,12,11,10,10,6,5,3,3,2,2,1,1,0,0,0,0&chds=0,100&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,2459FF,C79C6E,2459FF,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|howling_blast|obliterate_offhand|melee_main_hand|frost_strike_offhand|melee_off_hand|frost_fever|blood_plague|claw|melee|blood_strike|blood_strike_offhand|razorice|plague_strike|melee|plague_strike_offhand|claw&chtt=Death_Knight_Frost_1h_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:XXcnyzrw475225651w1631wvz21zwuw1zuqnpuxvsppsttsronmorssrqppqqnmllmprtuvvwvvwwxxxwvuuvwwwvvutuvvvvvvvuuuuutsrrrrssttssttuutqonnnnoppqrsttuvvvvuuuvvvvuuttttuuuuttttuuvvvuuuuvuuutuuuuuusrppoooopppqqrrsuuuuuvvwvvvvvvvvvvvvvvvvvvwwwwwwxxxxxxxwwwwvutsqponmmmmnnoooopppppqrrrrssttttuuuuuvvvvvvvwwvvvvwwwwwwwwwvvutsqponmllllmmnnnnoopppqqqrssstuuvvwwwxxyyyyyzzzz0000000001111211100zzyyyyyyyyzzzzz000100000111222222222222222221111100000zzyyxwwvvuuuuttuuuuuuuuvuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=85&chtt=Death_Knight_Frost_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yz12234455577777665543200yxwvutsrrrqppppooooonnnnmmmmmllllllllkkkkkjjjjiihhhhgggfffeeeddccccbbbbbbcccccdddeeffggghhhiiiiiiiiihhhhhhhhhggggfffffffeeeeeddddcccccccccccccccccccbcccccddddeeeeefffffggghhhhhiiiiiijjjjkkkklllllllllllkkkkkjjjiiihhhhhhggggggggggggggggffffffeeeeeeededddddeeeeeeeeeedddddddddddddddeeeffgghhiijjkkkllllllllkkkkjjjiiiiihhhhhhhhggggggggffffffffgggghhiijjkkllmmnnnnnnnnnmmmllllkkkkjjjjjjkkkkkkklllmmmmmmmmmmmmmmmmmmmmmmmmmlmllmllmlll&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26126|max=44643&chxp=1,1,59,100&chtt=Death_Knight_Frost_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,5,5,5,9,10,17,28,40,45,66,100,121,142,188,236,294,348,389,456,459,517,538,548,543,560,576,491,484,439,408,359,302,273,211,181,131,118,94,63,60,46,33,26,12,6,8,3,3,3&chds=0,576&chbh=5&chxt=x&chxl=0:|min=24083|avg=26126|max=28239&chxp=0,1,49,100&chtt=Death_Knight_Frost_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T11_372 26126
blood_plague 905 3.5% 20.9 33.57sec 19587 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149 2313 4834 17.0% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.89 20.89 149.20 149.20 0.0000 3.0000 409076
Direct Results Count Pct Average Min Max Total Damage
hit 20.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 123.8 82.97% 2312.50 1588 3924 286284
crit 25.4 17.03% 4833.64 3318 8202 122792

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 439 1.7% 31.0 14.66sec 6394 4480 5673 11698 16445 12.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.03 31.03 0.00 0.00 1.4274 0.0000 198385
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 88.04% 5673.32 3702 8143 154964
crit 3.7 11.96% 11698.49 7583 16445 43420

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_strike_offhand 274 1.1% 31.0 14.66sec 3999 0 3550 7305 10277 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.03 31.03 0.00 0.00 0.0000 0.0000 124066
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 88.05% 3550.04 2300 5089 96983
crit 3.7 11.95% 7305.03 4792 10277 27083

Action details: blood_strike_offhand

Static Values
  • id:66215
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:425.34
  • base_dd_max:425.34
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 6.5 72.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.48 6.48 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.5 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 325.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.86 1.86 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1269 4.9% 74.4 6.11sec 7715 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3221 6732 17.0% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.37 74.37 150.35 150.35 0.0000 3.0000 573757
Direct Results Count Pct Average Min Max Total Damage
hit 74.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.9 83.04% 3220.90 2184 5418 402142
crit 25.5 16.96% 6732.26 4565 10920 171615

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 4009 15.3% 125.0 3.58sec 14503 10134 10771 22161 35638 32.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
125.00 125.00 0.00 0.00 1.4311 0.0000 1812928
Direct Results Count Pct Average Min Max Total Damage
hit 84.0 67.23% 10771.13 7636 17033 905190
crit 41.0 32.77% 22160.54 15731 35638 907738

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
frost_strike_offhand 2510 9.6% 125.0 3.58sec 9081 0 6741 13869 22279 32.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
125.00 125.00 0.00 0.00 0.0000 0.0000 1135118
Direct Results Count Pct Average Min Max Total Damage
hit 84.0 67.17% 6741.03 4775 10648 566024
crit 41.0 32.83% 13869.04 9836 22279 569094

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:runic_power
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:139.53
  • base_dd_max:139.53
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 3142 12.0% 68.6 6.57sec 20718 17242 18145 37946 63669 14.7% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.59 68.59 0.00 0.00 1.2016 0.0000 1421097
Direct Results Count Pct Average Min Max Total Damage
hit 57.2 83.38% 18145.29 12175 31515 1037689
crit 10.1 14.73% 37945.73 25446 63669 383407
miss 1.3 1.89% 0.00 0 0 0

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2692 10.3% 294.0 1.54sec 4141 2695 4715 9716 14651 11.9% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
293.96 293.96 0.00 0.00 1.5367 0.0000 1217329
Direct Results Count Pct Average Min Max Total Damage
hit 133.1 45.27% 4714.83 3408 7170 627491
crit 35.1 11.93% 9715.77 7021 14651 340679
glance 70.5 23.98% 3535.16 2556 5378 249158
miss 55.3 18.82% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1679 6.4% 293.3 1.54sec 2588 1681 2945 6067 8954 11.9% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
293.33 293.33 0.00 0.00 1.5400 0.0000 759146
Direct Results Count Pct Average Min Max Total Damage
hit 132.9 45.30% 2945.01 2130 4481 391325
crit 35.0 11.94% 6067.18 4388 8954 212555
glance 70.3 23.96% 2208.85 1598 3361 155265
miss 55.1 18.79% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 4440 17.0% 82.9 5.47sec 24227 16998 17133 35565 53914 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.89 82.89 0.00 0.00 1.4253 0.0000 2008072
Direct Results Count Pct Average Min Max Total Damage
hit 51.0 61.51% 17132.89 12282 26908 873491
crit 31.9 38.49% 35564.78 25300 53914 1134581

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
obliterate_offhand 2778 10.6% 82.9 5.47sec 15158 0 10721 22247 33696 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.89 82.89 0.00 0.00 0.0000 0.0000 1256353
Direct Results Count Pct Average Min Max Total Damage
hit 51.0 61.51% 10721.31 7676 16818 546585
crit 31.9 38.49% 22247.04 15813 33696 709767

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% offhand weapon damage plus a bonus. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:325.19
  • base_dd_max:325.19
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.2 67.11sec 0 0 0 0 0 0.0% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.22 7.22 0.00 0.00 1.2005 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.1 97.99% 0.00 0 0 0
miss 0.1 2.01% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.83 7.83 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.8 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 79 0.3% 6.9 65.87sec 5170 3607 4583 9469 14173 12.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 1.4331 0.0000 35692
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 88.00% 4583.07 3547 7079 27844
crit 0.8 12.00% 9469.29 7307 14173 7848

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 49 0.2% 6.9 65.87sec 3230 0 2867 5912 8857 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 0.0000 0.0000 22300
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 88.08% 2866.83 2216 4424 17433
crit 0.8 11.92% 5911.80 4566 8857 4867

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% offhand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:210.42
  • base_dd_max:210.42
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
razorice 254 1.0% 484.4 0.93sec 237 0 237 0 338 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.45 484.45 0.00 0.00 0.0000 0.0000 114903
Direct Results Count Pct Average Min Max Total Damage
hit 484.4 100.00% 237.18 179 338 114903

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:949.00
  • base_dd_max:1764.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
pet - army_of_the_dead_ghoul_8 1294
claw 557 43.1% 12.0 3.09sec 1626 0 1491 2983 2983 9.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 19512
Direct Results Count Pct Average Min Max Total Damage
hit 10.9 90.98% 1491.43 1491 1491 16282
crit 1.1 9.02% 2982.86 2983 2983 3230

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 737 56.9% 21.0 1.62sec 1228 757 1189 2379 2379 9.2% 0.0% 23.8% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 21.00 0.00 0.00 1.6225 0.0000 25779
Direct Results Count Pct Average Min Max Total Damage
hit 14.1 66.99% 1189.27 1189 1189 16730
crit 1.9 9.18% 2378.55 2379 2379 4584
glance 5.0 23.84% 891.95 892 892 4465

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1658
claw 941 56.8% 105.8 3.83sec 3655 0 3348 6696 8749 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
105.78 105.78 0.00 0.00 0.0000 0.0000 386659
Direct Results Count Pct Average Min Max Total Damage
hit 96.1 90.82% 3347.92 2171 4374 321617
crit 9.7 9.18% 6695.68 4342 8749 65042

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 717 43.2% 124.5 3.23sec 2365 1802 2291 4587 5847 9.2% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.49 124.49 0.00 0.00 1.3126 0.0000 294372
Direct Results Count Pct Average Min Max Total Damage
hit 83.1 66.74% 2291.16 1491 2923 190353
crit 11.5 9.20% 4587.05 2982 5847 52536
glance 30.0 24.06% 1718.52 1118 2192 51483

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_1h_T11_372
frost_strike runic_power 98.6% 453.2 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 91.4 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 88.9 0.0 1.7%
chill_of_the_grave runic_power 150.2 1471.8 9.8 2.0%
frost_presence runic_power 126.1 197.8 1.6 0.8%
horn_of_winter runic_power 3.0 30.0 10.0 0.0%
improved_frost_presence runic_power 21.6 14.3 0.7 0.2%
rune_abilities runic_power 147.7 2320.9 15.7 1.4%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 392.2 2.8 0.0%
pet - ghoul energy
energy_regen energy 667.8 3979.3 6.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.7 0.0 54.8sec 54.8sec 28% 28%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
frost_presence 2.0 0.0 51.4sec 51.4sec 89% 86%

Database details

  • id:
  • cooldown name:buff_frost_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 395.0sec 395.0sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.7sec 104.7sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 49.0 2.7 9.1sec 8.7sec 13% 24%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.8 0.0 61.7sec 61.7sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 52.5 22.1 8.6sec 6.0sec 34% 76%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_razorice 1.0 483.4 0.0sec 0.9sec 100% 100%

Database details

  • id:
  • cooldown name:buff_rune_of_razorice
  • tooltip:(null)
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rune_of_the_fallen_crusader 10.8 31.3 42.7sec 10.6sec 75% 74%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 3.5 21.8 125.1sec 17.6sec 92% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence 1.0 0.0 0.0sec 0.0sec 11% 12%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 54.1 8.2sec
runic_empowerment_wasted 2.1 102.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.32%
σ of the average dps 5.9139
2 * σ / μ 0.0453%
95% Confidence Intervall ( μ ± 2σ ) ( 26113.78 - 26137.43 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26107.86 - 26143.34 )
Sample Data
σ 591.3890
Minimum 24082.72
Maximum 28238.68
Spread ( max - min ) 4155.97
Range ( max - min ) / 2 2077.98
Range% 7.95
10th Percentile 25405.74
90th Percentile 26909.05
( 90th Percentile - 10th Percentile ) 1503.31
Approx. Iterations needed for
1% dps error 20
0.1% dps error 2049
0.1 scale factor error with delta=300 3108
0.05 scale factor error with delta=300 12435
0.01 scale factor error with delta=300 310880
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
3 presence,choose=unholy,if=buff.bloodlust.react
4 army_of_the_dead
5 snapshot_stats
6 blood_fury,time>=10
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 pillar_of_frost
A raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
B raise_dead,time>=15
C outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
D howling_blast,if=dot.frost_fever.remains<=2
E plague_strike,if=dot.blood_plague.remains<=2
F obliterate,if=frost=2&unholy=2
G obliterate,if=death=2
H obliterate,if=buff.killing_machine.react
I blood_tap,if=buff.killing_machine.react
J empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
K blood_strike,if=blood=2
L frost_strike,if=runic_power>=90&!buff.bloodlust.react
M frost_strike,if=runic_power>=95
N howling_blast,if=buff.rime.react
O howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
P obliterate
Q empower_rune_weapon,if=target.time_to_die<=45
R frost_strike
S howling_blast
T blood_tap
U blood_strike,if=death=0
V empower_rune_weapon
W horn_of_winter

Sample Sequence

0124789C3FKAHIGMNPM6RKPNMRRKPPRRVFKNPMNHGMMNREPKMNPLNPKLNLPLNPLGGLLNOLRR2KUW9IHNRCPROKRPNLORKPLPLPLRPROERRUORPRUWPRGROOR9RTKP6NRPCNPLNLPLHLNOLPKLNRPLRKPNELORRPRSRUBHRT9WRHRPRORPCRUWPNRPRRHNRKPNORPLNPLEOLRRFHR9K6RTGNPLNRRPNRURCPNHROKPLRPNLPLRHNOLRPNRKEOLRUI9RPNRURPNPNLORPNLPLKCHLNRRGGNLRPNHLNRBPOKL6OL9ELKPLNLPLNPLNPLRIKHLOROCHLNPLNLPLNPLKNLPLNK9LPLENGLNLPLKJFGGLLNRPNKIGLLNCPLKNLPLNHLN7PL6OLRR9URUWERHNPNLPLHLNPLNHIKLLNHLGCGLHLBH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6983 5625 4957
Agility 721 138 20
Stamina 7574 5955 5780
Intellect 55 53 20
Spirit 85 85 20
Health 148991 126395 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 15.11% 15.11% 626
Spell Crit 13.79% 8.79% 1576
Spell Haste 17.66% 12.06% 1544
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16756 12380 190
Melee Hit 8.21% 8.21% 626
Melee Crit 16.75% 9.36% 1576
Melee Haste 12.06% 12.06% 1544
Expertise 26.91 26.91 808
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.94% 12.94% 886

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
tabard empty

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 3
Lichborne 0
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 3
Might of the Frozen Wastes 0
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_1h_T11_372
origin="http://chardev.org/?profile=75143"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
actions+=/presence,choose=unholy,if=buff.bloodlust.react
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/blood_strike,if=blood=2
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/blood_strike,if=death=0
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
# Gear Summary # gear_strength=4957
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=808
# gear_hit_rating=626
# gear_crit_rating=1576
# gear_haste_rating=1544
# gear_mastery_rating=886
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_razorice
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_2h_T11_372 : 25765dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25765.2 13.72 / 0.05% 2033.6 12.7 12.8 runic_power 7.42% 58.9
Origin http://chardev.org/?profile=61432
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://2.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:32455|20458|16805|8778|7313|3768|1780|853&chds=0,64911&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++32455++obliterate,C79C6E,0,0,15|t++20458++frost_strike,2459FF,1,0,15|t++16805++howling_blast,2459FF,2,0,15|t++8778++blood_strike,C79C6E,3,0,15|t++7313++plague_strike,C79C6E,4,0,15|t++3768++melee_main_hand,C79C6E,5,0,15|t++1780++melee,C79C6E,6,0,15|t++853++melee,C79C6E,7,0,15&chtt=Death_Knight_Frost_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:32,26,15,11,4,3,3,3,3,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|claw|blood_strike|blood_plague|melee|plague_strike|melee|claw&chtt=Death_Knight_Frost_2h_T11_372+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:Tny782vu142ywy120yxxywuuuwvtssvxuqmoqqqonnnppnmllknmmkkjjklljfdefikkkjkkkjjiihhhggfeefffeeddcdccbbcabaaZZYXXYYZYYXXYYZYYXVTTTTUUVVXYbbbbaaaaaaZZZZaaZZYXYYZYYXXXXYYZYYXXWXWWWWVWXXXXXWVUUTTTTUVXXYXXYZbccbbaaZaaaZZZZZZZZYXYXYYYYXXXYYZZZXXWXXXXWWVVUUTTSSTUVVVVWVWXXXXXYZZaaaZZYZZZZYYYYYZYYYXXYYYYYYXYYZZZXXWWVVUTTSSTUUUUVVVWWXWWWXXXXYZZZaaabaaaaaabbbabbcddddeeffgggghiijiihgfffffffffefffeeeededdddccddeeeeeeeeddddccccccbbbbbaaaaZZZZYXXWWVVUUUUUVVVWWWWWWXWX&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=106&chtt=Death_Knight_Frost_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:xy0012334547677777666543210zyxvvuuttssrrrqrqqqqqppppppooooooooooononnnnmmllllkkkjjiihhhggffefeeeedeeeeeeeeeffgfggggghhhhhhihiijjjjjjjkjkjkjjjjjjiiihhggfffeeeedddddddddddddcdcdcdddddeefffffggghhiijjjkkkkkkkkklllklklllllllllllllllllllkkkkjkjjjjjjjjjijijiiiiiiiiiiihhhhhhgggggggggfgfffffffffffffeeeeeeeeeeeeeeefffggghhiijijjjkkkkkklklkklkkkkkllllllllllllllkkkkkkkkkkllllmmmnnooppqqqqrrrrqqqqpppooonnnnnmnmmmmmnnnnnnnnnnnnmmmmlllllllklklllllllmmmmmmnnnnnnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25765|max=41774&chxp=1,1,62,100&chtt=Death_Knight_Frost_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,3,11,14,15,29,32,56,83,103,147,191,232,267,348,458,496,537,622,591,619,616,619,602,497,547,427,359,312,267,221,168,138,118,80,52,42,30,17,8,11,6,2,2,1,1,0,0,1&chds=0,622&chbh=5&chxt=x&chxl=0:|min=23379|avg=25765|max=28774&chxp=0,1,44,100&chtt=Death_Knight_Frost_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T11_372 25765
blood_plague 786 3.1% 14.2 33.15sec 25096 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149 2117 4423 11.5% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.16 14.16 149.25 149.25 0.0000 3.0000 355378
Direct Results Count Pct Average Min Max Total Damage
hit 14.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 132.1 88.54% 2116.80 1600 3431 279727
crit 17.1 11.46% 4422.80 3344 7170 75651

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 789 3.1% 40.3 11.28sec 8867 8778 8307 17123 23664 6.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.25 40.25 0.00 0.00 1.0102 0.0000 356907
Direct Results Count Pct Average Min Max Total Damage
hit 37.7 93.54% 8307.37 5212 11487 312793
crit 2.6 6.40% 17122.79 12617 23664 44113
miss 0.0 0.06% 0.00 0 0 0

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 7.2 64.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.20 7.20 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.2 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 306.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.95 1.95 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1023 4.0% 82.3 5.51sec 5624 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2736 5718 11.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.29 82.29 150.35 150.35 0.0000 3.0000 462770
Direct Results Count Pct Average Min Max Total Damage
hit 82.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.1 88.52% 2735.74 2067 4447 364117
crit 17.3 11.48% 5717.61 4321 9295 98652

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 8154 31.6% 179.0 2.51sec 20596 20458 15365 31604 47898 32.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
179.05 179.05 0.00 0.00 1.0067 0.0000 3687583
Direct Results Count Pct Average Min Max Total Damage
hit 121.2 67.70% 15365.45 12355 23251 1862577
crit 57.7 32.25% 31604.36 25451 47898 1825006
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 2807 10.9% 75.0 5.95sec 16930 16805 15348 32093 54048 9.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.97 74.97 0.00 0.00 1.0074 0.0000 1269280
Direct Results Count Pct Average Min Max Total Damage
hit 67.9 90.56% 15348.18 11512 25860 1042033
crit 7.1 9.44% 32093.41 24061 54048 227247

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3762 14.6% 223.2 2.03sec 7624 3768 7563 15587 22335 6.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
223.16 223.16 0.00 0.00 2.0232 0.0000 1701316
Direct Results Count Pct Average Min Max Total Damage
hit 155.1 69.48% 7563.06 6202 10842 1172737
crit 14.4 6.46% 15587.15 12775 22335 224824
glance 53.6 24.00% 5670.93 4651 8132 303754
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 6755 26.2% 93.1 4.86sec 32797 32455 24396 50727 74903 31.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
93.14 93.14 0.00 0.00 1.0105 0.0000 3054874
Direct Results Count Pct Average Min Max Total Damage
hit 63.3 68.00% 24396.30 19728 36361 1545303
crit 29.8 31.95% 50727.04 40639 74903 1509571
miss 0.0 0.05% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.32 7.32 0.00 0.00 1.0142 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.84 7.84 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.8 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 112 0.4% 6.8 66.54sec 7383 7313 6901 14262 20756 6.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.85 6.85 0.00 0.00 1.0095 0.0000 50541
Direct Results Count Pct Average Min Max Total Damage
hit 6.4 93.38% 6900.62 6046 10076 44113
crit 0.5 6.58% 14261.70 12455 20756 6428
miss 0.0 0.04% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 1445
claw 605 41.8% 13.0 2.78sec 1628 0 1491 2983 2983 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21166
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.67% 1491.43 1491 1491 17580
crit 1.2 9.25% 2982.86 2983 2983 3586
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.04% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 841 58.2% 24.0 1.44sec 1226 853 1189 2379 2379 9.2% 0.1% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 29419
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.67% 1189.27 1189 1189 19030
crit 2.2 9.18% 2378.55 2379 2379 5238
glance 5.8 24.07% 891.95 892 892 5152
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1614
claw 899 55.7% 110.1 3.68sec 3354 0 3074 6145 7643 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
110.09 110.09 0.00 0.00 0.0000 0.0000 369231
Direct Results Count Pct Average Min Max Total Damage
hit 99.9 90.72% 3074.48 2184 3822 307059
crit 10.1 9.19% 6144.75 4368 7643 62172
dodge 0.0 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 714 44.3% 135.5 2.97sec 2164 1780 2099 4197 5107 9.2% 0.1% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
135.49 135.49 0.00 0.00 1.2157 0.0000 293158
Direct Results Count Pct Average Min Max Total Damage
hit 90.3 66.68% 2099.17 1499 2553 189651
crit 12.4 9.18% 4197.43 2998 5107 52221
glance 32.6 24.05% 1573.75 1124 1915 51287
dodge 0.1 0.04% 0.00 0 0 0
miss 0.1 0.04% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_2h_T11_372
frost_strike runic_power 100.0% 643.6 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 83.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.6 89.6 0.0 0.9%
chill_of_the_grave runic_power 168.1 1657.2 9.9 1.4%
horn_of_winter runic_power 11.5 114.6 10.0 0.0%
improved_frost_presence runic_power 185.6 113.0 0.6 0.4%
might_of_the_frozen_wastes runic_power 100.3 988.5 9.9 1.4%
power_refund runic_power 0.1 2.4 28.8 0.0%
rune_abilities runic_power 185.6 2810.5 15.1 0.9%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 443.0 3.2 0.0%
pet - ghoul energy
energy_regen energy 668.4 4167.3 6.2 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.2 0.0 58.1sec 58.1sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 394.8sec 394.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 108.2sec 108.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 67.6 3.0 6.7sec 6.4sec 15% 25%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.8 0.0 61.7sec 61.7sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 40.5 1.5 11.1sec 10.7sec 15% 54%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 7.4 61.4 61.9sec 6.5sec 90% 89%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 3.0 26.9 140.0sec 15.0sec 94% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 78.7 5.7sec
runic_empowerment_wasted 1.7 103.6sec

Statistics & Data Analysis

DPS
Population
Convergence 70.72%
σ of the average dps 6.8616
2 * σ / μ 0.0533%
95% Confidence Intervall ( μ ± 2σ ) ( 25751.45 - 25778.89 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25744.58 - 25785.75 )
Sample Data
σ 686.1588
Minimum 23379.12
Maximum 28773.79
Spread ( max - min ) 5394.67
Range ( max - min ) / 2 2697.33
Range% 10.47
10th Percentile 24928.99
90th Percentile 26682.34
( 90th Percentile - 10th Percentile ) 1753.35
Approx. Iterations needed for
1% dps error 28
0.1% dps error 2836
0.1 scale factor error with delta=300 4185
0.05 scale factor error with delta=300 16740
0.01 scale factor error with delta=300 418501
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J blood_strike,if=blood=2
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T blood_strike,if=death=0
U empower_rune_weapon
V horn_of_winter

Sample Sequence

0123678BEJOL9MLOJ5LQOMOLLOLMJGLLGLJMLOLDFLMGLLMJQOMKOKHFKMKOKMQJQOMOKQQ8QTBGMKOKQOMOKQQJONQQOMJQOGKQNQJOMKOKMQDQNOMQQSRQTOMQQUEJOKMKQR8QOMQQTV5OMBQNQTQOQRQQOMOKMQQGMQOMQQTOQNQTVQSDOQQNTQ8OMAQQTVQOOMQQQTBOOQQQTNQGQGQNQOQTVQONQQTQOQOMOQQNHDGKMKQOQJ8QOQTQV5GMGQQTQRNQTQOMQBGMQOQNGKQQVQTOMQQTQOMOMKQOQSRGKQDNQQJ8QOMQTQOQOQTVQTGQGQRNQQTBGQOMQNJGKMKQQOJMOKMKOKJMKGKOKQO8QADQQSO5QNVQTGQTQOMQOQOQNQVQBTOQQOQTNQOMQNQQNNQTUEJGKOKMK8QJOMKNKNDKOKQQSJOMOKQQQJOOKQQVOOKQQTOQQBOMQTOQOMQQOMOMKQVQGQ68NQO5MQNQJONQQDQSFMOKQQVTGQOQNQQTOMQRNQQOMQQJBOMGKMKOKGKQAQ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7661 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150223 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 8.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16895 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01% 15.01% 1257

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_2h_T11_372
origin="http://chardev.org/?profile=61432"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/blood_strike,if=blood=2
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/blood_strike,if=death=0
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard=tabard_of_ramkahen,ilevel=85
# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T11_372 : 26477dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26477.2 11.23 / 0.04% 21.8 1212.1 1198.9 mana 0.00% 41.4
Origin http://chardev.org/?profile=34049
Talents http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
Glyphs
  • focus
  • rebirth
  • starfall
  • mark_of_the_wild
  • unburdened_rebirth
  • dash
  • starsurge
  • insect_swarm
  • moonfire

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:88617|83026|74955|43291|41442|16995|16057|1930&chds=0,177235&chco=336600,69CCF0,69CCF0,336600,8AD0B1,69CCF0,336600,C79C6E&chm=t++88617++sunfire,336600,0,0,15|t++83026++moonfire,69CCF0,1,0,15|t++74955++starfall,69CCF0,2,0,15|t++43291++insect_swarm,336600,3,0,15|t++41442++starsurge,8AD0B1,4,0,15|t++16995++starfire,69CCF0,5,0,15|t++16057++wrath,336600,6,0,15|t++1930++treant_melee,C79C6E,7,0,15&chtt=Druid_Balance_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:24,23,16,12,11,7,6,1,0,0&chds=0,100&chco=336600,69CCF0,8AD0B1,69CCF0,336600,336600,69CCF0,C79C6E,336600,C41F3B&chl=wrath|starfire|starsurge|moonfire|insect_swarm|sunfire|starfall|treant_melee|wild_mushroom_detonate|darkmoon_card_volcano&chtt=Druid_Balance_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:n00zzyxxw05777665443100zzyyxxyz0zyxwvvuttttssssstvxzzzzzzyyxxxwwwvvvuutuuuuvwxyyxxwwvvuuttttsssstuvwxxyyyyyyyxxxwwvvvuuuuuuvvwwwwwwwwvvvuutttsssssttuvwxxyyyxxxwwwwvvuuuutttuuvvwwwwwwvvuutsssrrrrrsssttuuvvvvvvvuuuttsssssrssssttuuuuuutttsssrrrrrrrrssttttuuuuuuutttsssrrrrrrrrrssstttttttttsssrrrrrrrssstttttttttttssssrrrrrrrrrrrssstttuuuuutttssssssssttttuuuuuuuttttsssrrrqqrrrrsstttuuuuuuuuttttttttttttttuuuttttttssssrrrrrrsssttuuvvvvvvvvvuuuuuutttttttuuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=121188&chtt=Druid_Balance_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:wy34566665555784232345421zyxxwwuuutttssrrponmlmnmmmlmlmmmmmllkjiiiihgfffffffffeeffghhgggggggghhhhhhiijjjjkkkkllkkkjjiijjjjjjjijjjjjjjjjjjjjjiiiiiihhhhggfggggggfffeeeeeedddeefgghhijjklllllllmmmmmmmlllkkjjjjiiijjjjjiijjjjjjjjjkklmmnnnooonnmmllkkkkjjihhggffeeedddddddddddeeeffgghhiijkkllllllkkkjjihhhgggfffeeeeeeeeeeefgghiijkklmnnnooooppppoonmmlkjjihggfffffffffffffgggghhijkllmmnnooooooonnnnnmlkkjiihggfffeeeeeeeefffgghhijjklmmnoppppqqpppoonmmmllkjjiihhgg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26477|max=43487&chxp=1,1,61,100&chtt=Druid_Balance_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,1,2,6,6,20,32,53,69,95,119,168,231,268,367,443,479,541,535,597,611,632,639,578,576,499,465,395,335,262,240,193,152,107,73,59,49,34,31,17,6,4,4,2,0,0,1,0,1&chds=0,639&chbh=5&chxt=x&chxl=0:|min=24482|avg=26477|max=28937&chxp=0,1,45,100&chtt=Druid_Balance_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Balance_T11_372 26477
darkmoon_card_volcano 71 0.3% 10.2 46.38sec 3140 0 2682 4150 4884 31.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 32110
Direct Results Count Pct Average Min Max Total Damage
hit 7.0 68.58% 2681.73 2568 3161 18807
crit 3.2 31.35% 4150.17 3968 4884 13304
miss 0.0 0.07% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
insect_swarm 2854 10.8% 26.0 17.75sec 49660 43291 0 0 0 0.0% 0.1% 0.0% 0.0% 304 3415 5203 46.1% 0.0% 99.7%

Stats details: insect_swarm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.99 25.99 304.50 304.50 1.1471 1.4808 1290582
Direct Results Count Pct Average Min Max Total Damage
hit 26.0 99.92% 0.00 0 0 0
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.2 53.92% 3414.68 2428 6467 560686
crit 140.3 46.08% 5202.51 3752 9992 729896

Action details: insect_swarm

Static Values
  • id:5570
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1490.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:$w1 Nature damage every $t1 sec.
  • description:The enemy target is swarmed by insects, causing $o1 Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:136.15
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
moonfire 3152 11.9% 15.3 30.27sec 92871 83026 4231 8934 15653 34.4% 0.1% 0.0% 0.0% 193 4602 9398 48.1% 0.0% 59.2%

Stats details: moonfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.35 15.35 193.30 193.30 1.1186 1.3857 1425428
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 65.55% 4231.14 2831 7489 42571
crit 5.3 34.37% 8933.86 5918 15653 47124
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.3 51.87% 4602.20 2960 8065 461458
crit 93.0 48.13% 9397.84 6186 16856 874274

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional ${$m1*6*$} Arcane damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 1641 6.2% 8.9 49.82sec 83693 74955 0 0 0 0.0% 0.0% 0.0% 0.0% 87 6410 13519 29.3% 0.1% 19.3%

Stats details: starfall

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.86 8.86 87.41 87.41 1.1166 1.0000 741896
Direct Results Count Pct Average Min Max Total Damage
none 8.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.7 70.63% 6409.95 4178 10875 395695
crit 25.6 29.30% 13519.36 8732 22730 346201
miss 0.1 0.08% 0.00 0 0 0

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:You summon a flurry of stars from the sky on all targets within 30 yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d.
  • description:You summon a flurry of stars from the sky on all targets within 30 yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.247000
  • base_dd_min:368.70
  • base_dd_max:428.49

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • tree:balance
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6522.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
starfire 5970 22.5% 81.9 5.43sec 32954 16995 20798 48215 81985 44.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.92 81.92 0.00 0.00 1.9390 0.0000 2699664
Direct Results Count Pct Average Min Max Total Damage
hit 45.5 55.53% 20798.07 14768 39227 946098
crit 36.4 44.40% 48214.50 30865 81985 1753566
miss 0.1 0.08% 0.00 0 0 0

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:986.98
  • base_dd_max:1230.95
starsurge 4291 16.2% 37.5 12.10sec 51715 41442 33087 76050 124966 43.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.52 37.40 0.00 0.00 1.2479 0.0000 1940419
Direct Results Count Pct Average Min Max Total Damage
hit 21.0 56.11% 33087.07 22394 59792 694382
crit 16.4 43.81% 76050.24 46804 124966 1246038
miss 0.0 0.08% 0.00 0 0 0

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.535000
  • base_dd_min:1272.16
  • base_dd_max:1756.79
sunfire 1743 6.6% 7.9 57.02sec 100088 88617 4981 10472 15653 34.2% 0.1% 0.0% 0.0% 96 5325 11236 38.8% 0.0% 30.7%

Stats details: sunfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.88 7.88 96.41 96.41 1.1294 1.4421 788464
Direct Results Count Pct Average Min Max Total Damage
hit 5.2 65.71% 4980.96 4352 7489 25785
crit 2.7 34.19% 10471.73 9096 15653 28206
miss 0.0 0.09% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 59.0 61.21% 5325.47 4549 8065 314264
crit 37.4 38.79% 11236.06 9508 16856 420210

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional ${$m1*4*$} Nature damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 82 0.3% 1.0 0.00sec 37149 0 31949 49361 49361 30.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 37149
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 69.88% 31948.58 31949 31949 22326
crit 0.3 30.03% 49360.55 49361 49361 14823
miss 0.0 0.09% 0.00 0 0 0

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.603200
  • base_dd_min:845.04
  • base_dd_max:1022.45
wrath 6290 23.8% 121.5 3.61sec 23418 16057 15271 34629 58192 42.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.46 121.09 0.00 0.00 1.4584 0.0000 2844400
Direct Results Count Pct Average Min Max Total Damage
hit 69.5 57.40% 15270.53 10437 27843 1061300
crit 51.5 42.52% 34628.87 21813 58192 1783100
miss 0.1 0.08% 0.00 0 0 0

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]$?s33891[ |C0033AA11Tree of Life: Cast time reduced by 50%, damage increased by 30%.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:675.17
  • base_dd_max:761.36
pet - treants 450
treant_melee 450 100.0% 60.8 6.39sec 2862 1930 3038 6083 7514 0.2% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: treant_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
60.77 60.77 0.00 0.00 1.4828 0.0000 173890
Direct Results Count Pct Average Min Max Total Damage
hit 46.1 75.82% 3038.21 2755 3757 139985
crit 0.1 0.20% 6082.57 5510 7514 748
glance 14.6 23.95% 2278.37 2066 2818 33157
dodge 0.0 0.03% 0.00 0 0 0

Action details: treant_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.65
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Druid_Balance_T11_372
insect_swarm mana 6.9% 34.4 1445
moonfire mana 4.6% 57.1 1627
starfall mana 10.2% 13.2 6326
starfire mana 26.1% 18.8 1750
starsurge mana 12.3% 28.7 1799
sunfire mana 2.3% 61.5 1627
wrath mana 33.6% 15.4 1516
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29087.0 16.1 1.4%
euphoria mana 18.6 349551.5 18779.7 3.8%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101725.0 101725.0 0.0%
innervate mana 14.6 20909.5 1433.7 23.7%
mp5_regen mana 1809.6 83064.0 45.9 1.4%
omen_of_clarity none 21.6 41219.7 1907.2 0.0%
replenishment mana 1809.6 53737.2 29.7 1.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.2sec 104.2sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 220.3 0.0 2.0sec 2.0sec 78% 78%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
innervate 0.4 0.0 213.3sec 213.3sec 1% 100%

Database details

  • id:
  • cooldown name:buff_innervate
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.3sec 52.3sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
lunar_eclipse 9.1 0.0 49.4sec 49.4sec 27% 55%

Database details

  • id:48518
  • cooldown name:buff_lunar_eclipse
  • tooltip:Damage done by your arcane spells increased by $w1%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_shower 23.2 0.0 19.9sec 19.9sec 15% 16%

Database details

  • id:81192
  • cooldown name:buff_lunar_shower
  • tooltip:Direct damage of your Moonfire increased by $s1%, and mana cost reduced by $s2%.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
natures_grace 19.4 0.0 23.9sec 23.9sec 63% 65%

Database details

  • id:
  • cooldown name:buff_natures_grace
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
omen_of_clarity 21.7 1.0 20.0sec 19.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
power_torrent_mh 10.1 0.0 47.1sec 47.1sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shooting_stars 22.1 1.7 19.8sec 18.3sec 9% 57%

Database details

  • id:93400
  • cooldown name:buff_shooting_stars
  • tooltip:Cast time of your next Starsurge reduced by $s1%.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:4.00%
solar_eclipse 9.6 0.0 48.7sec 48.7sec 31% 54%

Database details

  • id:48517
  • cooldown name:buff_solar_eclipse
  • tooltip:Damage done by your nature spells increased by $w1%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_caster 18.6 0.0 24.4sec 24.4sec 24% 20%

Database details

  • id:
  • cooldown name:buff_t11_4pc_caster
  • tooltip:(null)
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
treants-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
moonkin_form

Database details

  • id:24858
  • cooldown name:buff_moonkin_form
  • tooltip:Arcane and Nature spell damage increased by $24905s3%. Immune to Polymorph effects. All damage reduced by $24905s1%. Spell haste of all party and raid members increased by $24907s1%
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
unaligned_eclipse_gain 0.3 159.0sec
wrong_eclipse_starfire 1.0 146.7sec
wrong_eclipse_wrath 3.4 98.4sec

Statistics & Data Analysis

DPS
Population
Convergence 71.01%
σ of the average dps 5.6165
2 * σ / μ 0.0424%
95% Confidence Intervall ( μ ± 2σ ) ( 26466.00 - 26488.46 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26460.38 - 26494.08 )
Sample Data
σ 561.6516
Minimum 24482.19
Maximum 28936.64
Spread ( max - min ) 4454.45
Range ( max - min ) / 2 2227.23
Range% 8.41
10th Percentile 25798.02
90th Percentile 27233.97
( 90th Percentile - 10th Percentile ) 1435.95
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1799
0.1 scale factor error with delta=300 2804
0.05 scale factor error with delta=300 11216
0.01 scale factor error with delta=300 280402
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 moonkin_form
4 snapshot_stats
5 volcanic_potion,if=!in_combat
6 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
7 faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
8 wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
9 berserking
A insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
B starsurge,if=buff.t11_4pc_caster.up
C starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
D wrath,if=buff.t11_4pc_caster.up
E wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
F wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
G typhoon,moving=1
H starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
I sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
J moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
K starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
L innervate,if=mana_pct<50
M treants,time>=5
N starfire,if=eclipse_dir=1&eclipse<80
O starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
P wrath,if=eclipse_dir=-1&eclipse>=-87
Q wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
R starfire,if=eclipse_dir=1
S wrath,if=eclipse_dir=-1
T starfire
U wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
V moonfire,moving=1
W sunfire,moving=1

Sample Sequence

013589AJKTTMNNNQDDPPPAKIPPPKPPPPPOCCAHNJKNNNKNNABDDDIPPPPPAKPPPPKJCCCCAHNKNJNNNQDABDPPPPIKPPPKAPPOCCCHJKANNNNNNQBDIAPPPPPPPKPPPJASO9BCCHKMJNNANNNNQBDPIPPAPPPKPPPPPJSCACBHNNKJNNNARQDDBDIPPPAPPKPKPPPCCHAJNKNNKNNNNADDDBIPPPPPAPPPPKPJSCCABHNNNJNNNKNABDBP9PPIPPMAPPPPKPPOCCAHJNNKNNNNNADDDBDIPPPPAPPPKPOBCHJNNANNNKNNJBDDAPPPPPPPJKPPAPPOCCCHJKANNNNNQDD6IKPAKPPPKPKPKPJSACCCHKNN9JNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 699 117 20
Agility 693 111 20
Stamina 7588 5968 5862
Intellect 6013 5293 4595
Spirit 1765 1765 1591
Health 145435 122825 0
Mana 107575 97750 0
Spell Power 9031 7490 2207
Spell Hit 16.93% 16.93% 143
Spell Crit 24.46% 18.35% 778
Spell Haste 23.87% 17.97% 2301
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 1797 469 0
Melee Hit 1.19% 1.19% 143
Melee Crit 18.94% 12.15% 778
Melee Haste 17.97% 17.97% 2301
Expertise 0.00 0.00 0
Armor 14998 10922 10922
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 7.80% 5.41% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.35% 14.35% 1138

Gear

Encoded
head stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2 security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
tabard empty

Talents

Balance Rank
Nature's Grace 3
Starlight Wrath 3
Nature's Majesty 2
Genesis 3
Moonglow 1
Balance of Power 2
Euphoria 2
Moonkin Form 1
Typhoon 1
Shooting Stars 2
Owlkin Frenzy 0
Gale Winds 2
Solar Beam 0
Dreamstate 2
Force of Nature 1
Sunfire 1
Earth and Moon 1
Fungal Growth 0
Lunar Shower 3
Starfall 1
Feral Rank
Feral Swiftness 0
Furor 0
Predatory Strikes 0
Infected Wounds 0
Fury Swipes 0
Primal Fury 0
Feral Aggression 0
King of the Jungle 0
Feral Charge 0
Stampede 0
Thick Hide 0
Leader of the Pack 0
Brutal Impact 0
Nurturing Instinct 0
Primal Madness 0
Survival Instincts 0
Endless Carnage 0
Natural Reaction 0
Blood in the Water 0
Rend and Tear 0
Pulverize 0
Berserk 0
Restoration Rank
Blessing of the Grove 2
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 2
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Balance_T11_372
origin="http://chardev.org/?profile=34049"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
glyphs=focus/rebirth/starfall/mark_of_the_wild/unburdened_rebirth/dash/starsurge/insect_swarm/moonfire
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/moonkin_form
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
actions+=/berserking
actions+=/insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
actions+=/starsurge,if=buff.t11_4pc_caster.up
actions+=/starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
actions+=/wrath,if=buff.t11_4pc_caster.up
actions+=/wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/typhoon,moving=1
actions+=/starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
actions+=/sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
actions+=/moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
actions+=/starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
actions+=/innervate,if=mana_pct<50
actions+=/treants,time>=5
actions+=/starfire,if=eclipse_dir=1&eclipse<80
actions+=/starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
actions+=/wrath,if=eclipse_dir=-1&eclipse>=-87
actions+=/wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
actions+=/starfire,if=eclipse_dir=1
actions+=/wrath,if=eclipse_dir=-1
actions+=/starfire
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
actions+=/moonfire,moving=1
actions+=/sunfire,moving=1
head=stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
chest=scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist=belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs=stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet=nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists=manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands=stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2=security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5862
# gear_intellect=4595
# gear_spirit=1591
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=778
# gear_haste_rating=2301
# gear_mastery_rating=1138
# gear_armor=10922
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Druid_Feral_T11_372 : 25534dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25533.8 10.43 / 0.04% 1649.2 15.5 15.3 energy 47.28% 34.1
Origin http://chardev.org/?profile=35492
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:65861|33984|33276|21154|14041|4818&chds=0,131721&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++65861++rake,C55D54,0,0,15|t++33984++ferocious_bite,C79C6E,1,0,15|t++33276++ravage,C79C6E,2,0,15|t++21154++shred,C79C6E,3,0,15|t++14041++mangle_cat,C79C6E,4,0,15|t++4818++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:27,25,20,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|rake|cat_melee|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:puiku48710zyvsqoonmljihgecbZXVXemolhdaYWVUUUUTTSSTTSTTTTTSVcggebZYWVVUUUUTTTSSSSSTTTTUYdggebZYWWVUUUUTTTTTSSSSSTTUYceecbZXVUUTTTTTTTTTTTTSSSTVZcedcbZXWVUTTTTTTTTTTUTUTTUWZdeedcaYXWVUUTTTTTTTTTTTTTUWZcdddcddeedcbZYWVTSSRRRSSTUWYbbcbaZXWWVVUUUUTTTTTTTTTUVXZbcccbZYXWVVUUUTTTTTTSSTTTVXZbbbbaYXWVUUTTTTTTTTTTSSTTVXZabbaZYXWVUUTTTTTTTTTTTTTUWXZabbaZYXWVVUTTTTTTTTTTTTTUVXYZaaZYXXWVUUUTTTTSSSSSSTTUVXYZZaabbbbaaZXWUTSRRQQQRRSTVWXYYYYXWWVUUUTTTTTSSSSSSTTUWXYZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Druid_Feral_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:qsuxyyyzz00124577765320zyxwwvvutrrppnnmmllkkjjihgggggghhhiiiijjjkjjjjjihhhggggghhiiiiiiijjjjkkkkkjiihgggggghhiiiiiiiiiiiiijjiiihggfffffgghhhhhhhhhhhhhhhihhhhggggggghhijjjjjkkjjjjjjjjjiiihhgggggghhiijjkllmmmnnnooooonnnnnmmmllllllkkkkkkjjjiiihhhhhhhhiiiiiiiiijjjjjjjjiihhggggghhhhhiiiiiiiiiiijjiiihhggggggghhhiiiiiiiiiiijjjjiiihhhhhhiijjkkkkkkkkkkkkkkkjjjiiiihhiiiiijjjjjjjjjjjjjjiiiiiiiiiijjjkklmmnoppqqrrrrrrrrrrrrqqqqpppooonnnnmmmmllkjjjjiijjiiiiiiiii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25534|max=41877&chxp=1,1,61,100&chtt=Druid_Feral_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,1,0,3,3,3,9,11,22,25,58,75,116,147,168,236,298,370,479,504,554,562,643,654,691,656,569,534,460,457,343,318,249,191,158,116,97,80,45,32,23,13,14,7,4,0,1&chds=0,691&chbh=5&chxt=x&chxl=0:|min=23243|avg=25534|max=27484&chxp=0,1,54,100&chtt=Druid_Feral_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372 25534
berserk 0 0.0% 2.8 195.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.76 2.76 0.00 0.00 1.0164 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4816 18.9% 547.6 0.83sec 3977 4818 2921 6047 7505 49.5% 10.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.64 547.64 0.00 0.00 0.8256 0.0000 2178206
Direct Results Count Pct Average Min Max Total Damage
hit 85.8 15.66% 2920.91 1848 3643 250470
crit 271.0 49.48% 6047.39 3807 7505 1638592
glance 131.5 24.01% 2199.36 1386 2732 289144
dodge 35.6 6.50% 0.00 0 0 0
miss 23.9 4.36% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 860 3.4% 11.2 41.03sec 34618 33984 21163 44517 73912 67.5% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.24 11.24 0.00 0.00 1.0186 0.0000 389202
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 21.66% 21163.29 2970 35880 51547
crit 7.6 67.46% 44516.70 6118 73912 337655
dodge 0.7 6.52% 0.00 0 0 0
miss 0.5 4.36% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.2327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 951 3.7% 51.6 8.73sec 8335 0 6109 12628 15510 44.3% 10.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.59 51.59 0.00 0.00 0.0000 0.0000 430000
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 44.87% 6108.93 5729 7529 141405
crit 22.9 44.30% 12627.66 11801 15510 288595
dodge 3.3 6.47% 0.00 0 0 0
miss 2.3 4.37% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s1% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 707 2.8% 22.2 20.67sec 14403 14041 10517 21704 25644 45.0% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.21 22.21 0.00 0.00 1.0257 0.0000 319916
Direct Results Count Pct Average Min Max Total Damage
hit 9.8 44.17% 10517.44 9610 12449 103192
crit 10.0 44.96% 21703.86 19797 25644 216724
dodge 1.5 6.54% 0.00 0 0 0
miss 1.0 4.33% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4996 19.6% 33.4 13.53sec 67575 65861 1883 3895 4670 44.2% 10.8% 0.0% 0.0% 146 9725 20120 49.5% 0.0% 96.1%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.44 33.44 146.22 146.22 1.0260 2.9722 2259814
Direct Results Count Pct Average Min Max Total Damage
hit 15.0 44.98% 1883.31 1778 2267 28330
crit 14.8 44.21% 3895.11 3663 4670 57581
dodge 2.2 6.49% 0.00 0 0 0
miss 1.4 4.32% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.9 50.53% 9725.41 9157 12018 718624
crit 72.3 49.47% 20120.36 18864 24756 1455279

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 74 0.3% 1.0 0.00sec 33568 33276 23014 47414 47613 53.9% 11.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0088 0.0000 33568
Direct Results Count Pct Average Min Max Total Damage
hit 0.3 34.77% 23014.37 20098 23113 8002
crit 0.5 53.92% 47413.97 41403 47613 25566
dodge 0.1 6.92% 0.00 0 0 0
miss 0.0 4.39% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6824 26.7% 17.1 23.05sec 180116 175730 0 0 0 0.0% 11.0% 0.0% 0.0% 212 9500 19653 49.8% 0.0% 93.8%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.14 17.14 212.10 212.10 1.0250 2.0000 3086525
Direct Results Count Pct Average Min Max Total Damage
hit 15.3 89.01% 0.00 0 0 0
dodge 1.1 6.59% 0.00 0 0 0
miss 0.8 4.40% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 106.6 50.24% 9499.73 8719 11527 1012251
crit 105.5 49.76% 19652.89 17962 23746 2074274

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.97 13.97 0.00 0.00 1.0259 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6306 24.7% 131.9 3.38sec 21626 21154 15888 32849 39324 44.0% 10.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
131.89 131.89 0.00 0.00 1.0223 0.0000 2852355
Direct Results Count Pct Average Min Max Total Damage
hit 59.6 45.18% 15887.60 15022 19089 946750
crit 58.0 43.98% 32849.30 30946 39324 1905604
dodge 8.6 6.50% 0.00 0 0 0
miss 5.7 4.34% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.5 27.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.49 16.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.5 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372
feral_charge_cat energy 0.1% 0.0 10
ferocious_bite energy 6.7% 833.9 42
mangle_cat energy 10.2% 447.9 32
rake energy 14.3% 2257.4 30
rip energy 6.6% 6727.4 27
savage_roar energy 4.8% 0.0 24
shred energy 57.3% 710.3 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 88.6 564.1 6.4 0.0%
energy_regen energy 1809.6 4984.3 2.8 0.1%
omen_of_clarity none 28.3 1084.4 38.4 0.0%
tigers_fury energy 16.5 989.7 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.7sec 195.7sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 39.7 136.8 11.5sec 2.6sec 78% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 56.1sec 56.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 28.3 0.3 15.6sec 15.4sec 3% 4%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.4sec 81.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.8sec 23.8sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.8 8.2 81.1sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.5 0.0 28.0sec 28.0sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.1sec 414.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.9 7.9sec
fury_swipes 51.6 8.7sec
primal_fury 83.3 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.46%
σ of the average dps 5.2131
2 * σ / μ 0.0408%
95% Confidence Intervall ( μ ± 2σ ) ( 25523.34 - 25544.19 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25518.12 - 25549.40 )
Sample Data
σ 521.3052
Minimum 23243.20
Maximum 27484.12
Spread ( max - min ) 4240.92
Range ( max - min ) / 2 2120.46
Range% 8.30
10th Percentile 24889.75
90th Percentile 26224.77
( 90th Percentile - 10th Percentile ) 1335.03
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1667
0.1 scale factor error with delta=300 2415
0.05 scale factor error with delta=300 9662
0.01 scale factor error with delta=300 241563
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBKIISMS9ESPSSFKSSSSSLSSSSSBIIKM9SSSPSKSSNSSBK9ISSSPSKSSSSSBIS9KMSSSSSLKIIBS9MKSSSSSIKBS9SNSKSSSSSSIKBS9SSSNKSSISBK9SSSSFSSSIKSSMSBK9SSSSISKKSSSBM9SKSLSIIISSSKKSSB9SSIKSLSMSKSIB9SSSKSSSSIKSB9MLLSSSSKSISSKB9SNSSSIKSSSB9JSSIFSSSSSKMSSSSHB9KKLSHSSSHKSB9HSMKSSHSKSM9BSSSHKSSHKS9BHASSMKKSSHKKB9JSHSLMS

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7051 5457 5366
Stamina 7572 5953 5847
Intellect 201 192 20
Spirit 192 192 20
Health 145211 122615 0
Mana 24572 24400 0
Spell Power 210 182 0
Spell Hit 4.26% 4.26% 436
Spell Crit 20.56% 15.54% 2222
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 24067 829 190
Melee Hit 3.63% 3.63% 436
Melee Crit 51.57% 37.66% 2222
Melee Haste 3.97% 3.97% 508
Expertise 0.00 0.00 0
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.65% 24.31% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.98% 19.98% 2148

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372
origin="http://chardev.org/?profile=35492"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5366
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=436
# gear_crit_rating=2222
# gear_haste_rating=508
# gear_mastery_rating=2148
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Druid_Feral_T11_372_hitcap : 25482dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25481.9 10.00 / 0.04% 1736.7 14.7 14.5 energy 49.16% 33.0
Origin http://chardev.org/?profile=35430
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://2.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:68619|35397|34965|22024|14551|4882&chds=0,137238&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++68619++rake,C55D54,0,0,15|t++35397++ferocious_bite,C79C6E,1,0,15|t++34965++ravage,C79C6E,2,0,15|t++22024++shred,C79C6E,3,0,15|t++14551++mangle_cat,C79C6E,4,0,15|t++4882++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372_hitcap+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,19,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|cat_melee|rake|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372_hitcap+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:nqdhv574utttoligfedcaZYWWVVUSSUenmhcYWUTTSTTSSRRRSSRRSSSSRVdgdaYWUUTTSTTSSSRRQRRSSSSSTZefdaYWVUTTTSTSSSSSSRQRRSSSUZddbZXWUTSSSSSSSSSSSSSRRRRSVZccbZXWVTSSRRRSSSSSSSSSSSSTXbddcaYWVUTTSSRRSSSSSSSSSSSUXaccbaabccbaYWUTSRQPPPPQQRSUWZaaZYXVUUTTTTSSSSRRSSSSSSTVYabbaYXWVUTTTSSSSSSRRRRRSSTVXZaaZYWVUTSSSSSSSSSSSSRRRSTVXZZZYXWVUTSSSSSSSSSSSSSSSTUVXZZZYXWVUTTSSSRRRSRSSSSSSTUVXYYYXWVUUTTSSSRRRRRRRRRSSTUWXXYYYYZZZYXWVTSRQPOOOPPQRSTVWXWWWVUTTSSSSSSSSRRRRRRRSTUWWXX&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=73&chtt=Druid_Feral_T11_372_hitcap+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwyzzzzz1023458765321zywwvvutsrqponmmlkkkjjihggffgfgggghhhiiijjjjjiiihggggffgghhhhhhhhiiijjjjjjjihgffffffgghhhhhhhhhhhiiiiiihhgfeeeeeffggghhhhggggggghhhhgggfffffgghhiijjjjjjjjiiijjiihhgggfffffgghhijjkklllmmmnnnnnmmmmmmlllkkkkkkjjjjjjiihhhggggggghhhhhhhhiiiiiiiiiihhggfffffgghhhhhhhhhhhhiiiiihhggffffffggghhhhhhhhhhhiiiiiihhhgggghhiijjjkkkkkkjjjjjjjjiihhhhghhhhhiiiijjjjjjiiiiiihhhhhhhhiiijjkklmnooppqqqqqqqqqqqqqqpppoonnnmmmmllllkkjjiihhhiiiiiiiiiijjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25482|max=42631&chxp=1,1,60,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,1,1,3,2,2,8,16,20,40,55,66,93,133,163,229,268,410,413,478,535,605,618,652,605,657,574,552,508,459,415,334,249,215,166,120,114,65,48,33,27,10,12,10,5,7,1,2&chds=0,657&chbh=5&chxt=x&chxl=0:|min=23366|avg=25482|max=27397&chxp=0,1,52,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372_hitcap 25482
berserk 0 0.0% 2.8 195.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.77 2.77 0.00 0.00 1.0170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4880 19.2% 547.7 0.83sec 4030 4882 2919 6038 7485 44.8% 3.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.73 547.73 0.00 0.00 0.8254 0.0000 2207388
Direct Results Count Pct Average Min Max Total Damage
hit 149.4 27.28% 2918.75 1843 3633 436169
crit 245.6 44.84% 6037.94 3796 7485 1482831
glance 131.4 23.99% 2194.89 1382 2725 288388
dodge 21.3 3.89% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 875 3.4% 11.0 43.18sec 36083 35397 21107 44324 73687 68.1% 4.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.97 10.97 0.00 0.00 1.0194 0.0000 395728
Direct Results Count Pct Average Min Max Total Damage
hit 3.1 27.94% 21106.85 2957 35770 64684
crit 7.5 68.10% 44324.22 6088 73687 331044
dodge 0.4 3.96% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.2327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 1041 4.1% 54.4 8.30sec 8658 0 6093 12598 15468 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.41 54.41 0.00 0.00 0.0000 0.0000 471087
Direct Results Count Pct Average Min Max Total Damage
hit 28.9 53.08% 6092.68 5712 7509 175976
crit 23.4 43.05% 12598.37 11766 15468 295110
dodge 2.1 3.87% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s1% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 670 2.6% 20.2 22.80sec 14971 14551 10482 21620 25582 43.9% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 0.00 0.00 1.0289 0.0000 303073
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 52.20% 10481.62 9586 12419 110770
crit 8.9 43.94% 21620.27 19746 25582 192304
dodge 0.8 3.86% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4863 19.1% 31.2 14.57sec 70549 68619 1888 3905 4676 43.2% 3.9% 0.0% 0.0% 147 9741 20154 44.8% 0.0% 96.6%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.18 31.18 146.90 146.90 1.0281 2.9737 2199786
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 52.88% 1888.20 1780 2270 31135
crit 13.5 43.22% 3904.58 3667 4676 52622
dodge 1.2 3.90% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 81.1 55.21% 9741.14 9160 12026 790082
crit 65.8 44.79% 20154.01 18870 24774 1325946

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 78 0.3% 1.0 0.00sec 35269 34965 23016 47421 47499 53.8% 3.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0087 0.0000 35269
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 42.35% 23015.93 20050 23058 9747
crit 0.5 53.82% 47420.84 41304 47499 25522
dodge 0.0 3.83% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6641 26.1% 15.8 24.88sec 189738 184746 0 0 0 0.0% 3.9% 0.0% 0.0% 213 9516 19690 45.3% 0.0% 94.1%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.83 15.83 212.74 212.74 1.0270 2.0000 3003765
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 96.11% 0.00 0 0 0
dodge 0.6 3.89% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 116.5 54.75% 9515.67 8726 11539 1108331
crit 96.3 45.25% 19689.68 17976 23771 1895435

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.96 13.96 0.00 0.00 1.0262 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6433 25.2% 129.1 3.45sec 22543 22024 15860 32802 39230 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
129.09 129.09 0.00 0.00 1.0236 0.0000 2909997
Direct Results Count Pct Average Min Max Total Damage
hit 68.5 53.03% 15859.61 14983 19043 1085658
crit 55.6 43.09% 32801.82 30865 39230 1824339
dodge 5.0 3.89% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.6 27.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.56 16.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.6 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372_hitcap
feral_charge_cat energy 0.2% 0.0 10
ferocious_bite energy 6.9% 859.7 42
mangle_cat energy 9.8% 467.4 32
rake energy 13.9% 2387.9 30
rip energy 6.3% 7140.3 27
savage_roar energy 5.1% 0.0 24
shred energy 57.9% 757.7 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 31.5 189.9 6.0 0.0%
energy_regen energy 1809.6 4986.1 2.8 0.0%
omen_of_clarity none 30.4 1170.4 38.4 0.0%
tigers_fury energy 16.6 993.6 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.4sec 195.4sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.2 138.5 11.4sec 2.5sec 79% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.7sec 55.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 30.5 0.4 14.5sec 14.3sec 3% 5%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.0sec 81.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.7sec 23.7sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.1 80.3sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:42.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.6 0.0 27.9sec 27.9sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.1sec 414.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.3 7.7sec
fury_swipes 54.4 8.3sec
primal_fury 78.5 5.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.39%
σ of the average dps 5.0022
2 * σ / μ 0.0393%
95% Confidence Intervall ( μ ± 2σ ) ( 25471.87 - 25491.88 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25466.87 - 25496.88 )
Sample Data
σ 500.2247
Minimum 23366.00
Maximum 27397.42
Spread ( max - min ) 4031.41
Range ( max - min ) / 2 2015.71
Range% 7.91
10th Percentile 24868.44
90th Percentile 26134.09
( 90th Percentile - 10th Percentile ) 1265.65
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1541
0.1 scale factor error with delta=300 2224
0.05 scale factor error with delta=300 8896
0.01 scale factor error with delta=300 222422
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBI9JMRSSSFPSSSKSLSSSSSIB9KMSSSSKSISB9KSSMSSKISB9SSSKSSLSIKMSSB9SSSKISSSMKB9QSSSIKKSSSSNKB9SISSSSKSSSIB9KSSSSFMSSSSSKSSSISB9KSSSSSSSIKSSSMS9BSSKSISLSKNSSS9BSSIIKSSSKB9ISSLMKSSSIK9BSSSNSKSSIS9BJSLPSSKNSS9BKISSFSSSPSKSSHS9BSSHKMSSSKHS9BSHSMKSSHSSKLH9BSSSMKSSHSKSB9HSASSNKSSB9IKSSHSSSO

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7018 5427 5336
Stamina 7572 5953 5847
Intellect 201 192 20
Spirit 192 192 20
Health 145211 122615 0
Mana 24572 24400 0
Spell Power 210 182 0
Spell Hit 9.38% 9.38% 961
Spell Crit 16.02% 11.00% 1408
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 23967 829 190
Melee Hit 8.00% 8.00% 961
Melee Crit 46.93% 33.03% 1408
Melee Haste 3.97% 3.97% 508
Expertise 10.42 10.42 313
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.56% 24.22% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 20.18% 20.18% 2184

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372_hitcap
origin="http://chardev.org/?profile=35430"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5336
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=313
# gear_hit_rating=961
# gear_crit_rating=1408
# gear_haste_rating=508
# gear_mastery_rating=2184
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Hunter_BM_T11_372 : 28007dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28007.4 8.27 / 0.03% 2639.3 10.6 10.5 focus 0.00% 60.8
Origin http://chardev.org/?profile=34113
Talents http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
Glyphs
  • bestial_wrath
  • kill_command
  • arcane_shot
  • kill_shot

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31829|26156|16089|10227|7179|4311|2896&chds=0,63658&chco=C79C6E,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E&chm=t++31829++kill_command,C79C6E,0,0,15|t++26156++kill_shot,C79C6E,1,0,15|t++16089++arcane_shot,69CCF0,2,0,15|t++10227++cobra_shot,336600,3,0,15|t++7179++claw,C79C6E,4,0,15|t++4311++ranged,C79C6E,5,0,15|t++2896++melee,C79C6E,6,0,15&chtt=Hunter_BM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:19,18,17,15,13,10,4,3&chds=0,100&chco=69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=arcane_shot|cobra_shot|kill_command|ranged|claw|melee|serpent_sting|kill_shot&chtt=Hunter_BM_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x832zwwqmlpx1sqz233uqy223vrx123wqv023xrv023yrv024zsv024zssw022yusw122ztrqnjhcXWVZhghntx1zuux021xuux12zxtuz110vswz12yttwz22xvtw121zusx012yttx020vsokieZWXclswusuz112vswz12zttwz21xuvx110wuvz110vswz02zttwz21yutx111ztrrokhcYXWYddfmrvzzvvwz11zwuv0100vtxz01yuvxz20wvvy11zwvvz00zvuxz01yuvxz10wtpljfbZYbiptusuy001xuwy020wvwy11zxvwz100xvxz01zwwyz11yxxy220zyz220zyyzyvtplkhefgjptvyxwyzz1zxyyy11zyxxz000yxzz01zxyzz10zzyy00z0zyz0z0zyzzz10yxurqokjiinqsvwwzzz10yzzz00&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=92&chtt=Hunter_BM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:62375543353302121zvvuuvupqqrqpmmnppommnopommnppommmmnnmllllmllmmnonnooppponnnnopommmmmlkkjjkkkjkkkllkkkkkkkjjkjkkkkkkkkkkkkkklkkkkkllmmmmnooonnnnnonmmnnnnlkkkkkjiijjkkkkkkkllkkkkkllkkkkklkkkkkkkjjjjjjjjjkllmmmnnnoonmmmnnnnmmlllkkjiiijjjjkkkkkklllllllllllllkllllkkkkkkkkjjjkkllmmnnooooooooonnnoonmlllkkkjjjjjkjkkkkkkkkkkkkkkkklllllllmmmnnnnoopppqrrsssttuuutssssssrrrqqpoonnmmmmmmmmmmmmmmmlllmmmmmmmmmmmmmmmmnnnnnnnoppqrrstuuvvvvvvvvvvvvuttsrqqqoopoopooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28007|max=42387&chxp=1,1,66,100&chtt=Hunter_BM_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,1,1,1,7,9,13,15,30,45,79,116,171,230,309,322,380,469,483,566,614,659,657,652,621,586,508,447,407,360,290,239,180,138,118,87,57,37,29,18,15,12,6,7,3,3,0,0,1&chds=0,659&chbh=5&chxt=x&chxl=0:|min=26419|avg=28007|max=29774&chxp=0,1,47,100&chtt=Hunter_BM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_BM_T11_372 28007
arcane_shot 5245 18.7% 146.2 3.08sec 16223 16089 11692 24245 31559 36.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.18 145.91 0.00 0.00 1.0083 0.0000 2371459
Direct Results Count Pct Average Min Max Total Damage
hit 92.9 63.67% 11692.05 10837 15320 1086111
crit 53.0 36.33% 24244.80 22323 31559 1285348

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 6.9 70.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:70.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped unless killed.
cobra_shot 4919 17.6% 178.6 2.47sec 12456 10227 9032 18652 23032 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.56 178.22 0.00 0.00 1.2180 0.0000 2224142
Direct Results Count Pct Average Min Max Total Damage
hit 114.4 64.16% 9031.91 8766 11181 1032822
crit 63.9 35.84% 18652.46 18059 23032 1191320

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
fervor 0 0.0% 1.7 155.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fervor

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.71 1.71 0.00 0.00 1.0053 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.7 100.00% 0.00 0 0 0

Action details: fervor

Static Values
  • id:82726
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly restores $s1 Focus to you and your pet.
focus_fire 0 0.0% 25.7 17.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.65 25.65 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 25.7 100.00% 0.00 0 0 0

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy Effect stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy Effect stack consumed. Lasts for $d.
kill_command 4817 17.2% 68.0 6.68sec 32010 31829 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.04 68.04 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 68.0 100.00% 0.00 0 0 0

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:37.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Give the command to kill, causing your pet to instantly inflict $ damage to its target. Your Pet's happiness increases the damage done. The pet must be in combat and within 5 yards of the target to Kill Command.
kill_shot 955 3.4% 16.4 5.42sec 26315 26156 19056 39377 50516 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.40 16.26 0.00 0.00 1.0061 0.0000 431613
Direct Results Count Pct Average Min Max Total Damage
hit 10.3 63.15% 19055.78 17624 24522 195669
crit 6.0 36.85% 39377.27 36305 50516 235945

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 4304 15.4% 237.8 1.91sec 8186 4311 5905 12226 16284 36.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
237.75 237.75 0.00 0.00 1.8991 0.0000 1946339
Direct Results Count Pct Average Min Max Total Damage
hit 151.9 63.91% 5904.94 5607 7905 897237
crit 85.8 36.09% 12226.45 11551 16284 1049102

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1182 4.2% 1.0 1.00sec 534529 515421 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2908 4505 41.0% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 150.02 150.02 1.0371 3.0000 534582
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 88.5 58.98% 2908.29 2793 3927 257311
crit 61.5 41.02% 4505.46 4315 6067 277271

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - cat 11404
call_of_the_wild 0 0.0% 2.7 210.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.67 2.67 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:210.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 3692 32.4% 151.3 3.00sec 11034 7179 6638 13527 21379 63.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.29 151.29 0.00 0.00 1.5370 0.0000 1669326
Direct Results Count Pct Average Min Max Total Damage
hit 54.7 36.19% 6638.35 2856 10689 363422
crit 96.5 63.81% 13526.52 5712 21379 1305904

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
kill_command 4817 42.2% 68.0 6.68sec 32010 0 19713 39685 65182 61.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.04 68.04 0.00 0.00 0.0000 0.0000 2177963
Direct Results Count Pct Average Min Max Total Damage
hit 26.1 38.43% 19712.79 17460 32591 515474
crit 41.9 61.57% 39685.23 34919 65182 1662490

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.19
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:926.00
  • base_dd_max:926.00
melee 2895 25.4% 418.3 1.08sec 3129 2896 2136 4309 6505 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
418.29 418.29 0.00 0.00 1.0806 0.0000 1308902
Direct Results Count Pct Average Min Max Total Damage
hit 102.5 24.51% 2136.42 1910 3252 219062
crit 215.4 51.49% 4309.02 3819 6505 928061
glance 100.4 24.00% 1611.75 1432 2439 161779

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 14.3 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.3 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_BM_T11_372
arcane_shot focus 54.8% 901.5 18
kill_command focus 44.9% 1010.5 32
serpent_sting focus 0.3% 42762.3 12
pet - cat
claw focus 100.0% 336.1 33
Resource Gains Type Count focus Average Overflow
cobra_shot focus 178.6 1605.3 9.0 0.1%
fervor focus 1.7 85.6 50.0 0.0%
focus_regen focus 1809.6 2499.6 1.4 0.3%
invigoration focus 96.5 574.5 6.0 0.8%
pet - cat focus
fervor focus 1.7 35.7 20.8 58.3%
focus_fire focus 25.7 85.3 3.3 16.9%
focus_regen focus 1809.6 4072.8 2.3 14.0%
go_for_the_throat focus 85.8 724.4 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 6.9 0.0 70.6sec 70.6sec 15% 12%

Database details

  • id:34471
  • cooldown name:buff_beast_within
  • tooltip:Enraged.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_ap 4.3 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cobra_strikes 18.0 3.9 24.4sec 19.9sec 19% 26%

Database details

  • id:53257
  • cooldown name:buff_cobra_strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
culling_the_herd 6.6 89.9 68.5sec 4.7sec 94% 94%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.5sec 57.5sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
focus_fire 25.7 0.0 17.5sec 17.5sec 84% 84%

Database details

  • id:82692
  • cooldown name:buff_focus_fire
  • tooltip:Ranged haste increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
killing_streak 15.8 0.0 27.8sec 27.8sec 23% 22%

Database details

  • id:
  • cooldown name:buff_killing_streak
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 5.9 0.0 82.8sec 82.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.9sec 394.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.4sec 55.4sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bestial_wrath 6.9 0.0 70.6sec 70.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_bestial_wrath
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 6.6 89.9 68.5sec 4.7sec 94% 93%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-frenzy 26.6 124.7 17.4sec 3.0sec 89% 92%

Database details

  • id:
  • cooldown name:buff_frenzy
  • tooltip:(null)
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 14.3 0.0 32.9sec 32.9sec 62% 62%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 14.3 381.7 32.9sec 1.1sec 98% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 47.0 6.1 9.6sec 8.4sec 18% 31%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.86%
σ of the average dps 4.1335
2 * σ / μ 0.0295%
95% Confidence Intervall ( μ ± 2σ ) ( 27999.18 - 28015.72 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27995.05 - 28019.85 )
Sample Data
σ 413.3493
Minimum 26419.34
Maximum 29774.36
Spread ( max - min ) 3355.02
Range ( max - min ) / 2 1677.51
Range% 5.99
10th Percentile 27486.41
90th Percentile 28556.64
( 90th Percentile - 10th Percentile ) 1070.23
Approx. Iterations needed for
1% dps error 8
0.1% dps error 871
0.1 scale factor error with delta=300 1518
0.05 scale factor error with delta=300 6074
0.01 scale factor error with delta=300 151873
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B bestial_wrath,if=focus>60
C multi_shot,if=target.adds>5
D cobra_shot,if=target.adds>5
E serpent_sting,if=!ticking
F kill_shot
G rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
H kill_command
I fervor,if=focus<=20
J focus_fire,five_stacks=1,if=!buff.beast_within.up
K arcane_shot,if=focus>=90|buff.beast_within.up
L cobra_shot

Sample Sequence

0134579BEHKKKKKHKKLLJLHLKLKLHLLKKLHLJLKLKHLLKLKLHLGKLJKLHLKLKLHLKLKKHJLLLKLHLKKLKBHKKKKKHKKKJLLHLLLLHLKLKLHJLLKLKHLLLKLHLJKLKLHLL9KLKHLLKJLKHLLKLKHLLLBKKHKKKKKHKJLLLKHLLLKLHLKJLKLHLKLKLHLLKJLKHLLKLKHLLKLJKHLLKLKHLLLKKBHKKKKKHKKKJLLHLLLLHLLKLKHJLLL9KLHLKLKKHLJLLKLHLLKLKHLLJKLKHLLLKKHLLBKKKHKKKKKHJLLLLLHLKLLKHLLJKLKHLLKLKHLLLJKLHLKLLKHLKLKLHJLGLKKLHLKLKKLBHKKKKKHKKK9JLLHLLKLKHLLLKKHJLLKLKHLLLKLHLJLKLKHLLKLKHLLJLKLHLLKLKHLLBKKKHKKKKKHJLLLLHFFLLKHLLJKLFFHKLKLKHLLFFJLHLKLKLHFFKLKHJLLL9KFFHL4LKLKBHKKFFKHKKKJLLHLFFLKHLLKLJKFFHLLLKLHLFFKJLHLLKLKHFFKLK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 8466 5817 5345
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 26125 14968 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.39% 29.23% 2305
Melee Haste 13.46% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.11% 6.87% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 2
One with Nature 3
Bestial Discipline 3
Pathfinding 0
Spirit Bond 2
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 3
Fervor 1
Focus Fire 1
Longevity 3
Killing Streak 2
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 1
Ferocious Inspiration 1
Kindred Spirits 2
The Beast Within 1
Invigoration 2
Beast Mastery 1
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 0
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_BM_T11_372
origin="http://chardev.org/?profile=34113"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
glyphs=bestial_wrath/kill_command/arcane_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/bestial_wrath,if=focus>60
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking
actions+=/kill_shot
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/fervor,if=focus<=20
actions+=/focus_fire,five_stacks=1,if=!buff.beast_within.up
actions+=/arcane_shot,if=focus>=90|buff.beast_within.up
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010122000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372 : 31639dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31639.1 15.97 / 0.05% 2788.7 11.3 11.2 focus 0.00% 59.9
Origin http://chardev.org/?profile=34117
Talents http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
Glyphs
  • steady_shot
  • aimed_shot
  • rapid_fire

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:35864|22363|20407|7407|4498|3322|1582&chds=0,71728&chco=336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++35864++chimera_shot,336600,0,0,15|t++22363++aimed_shot,C79C6E,1,0,15|t++20407++kill_shot,C79C6E,2,0,15|t++7407++steady_shot,C79C6E,3,0,15|t++4498++ranged,C79C6E,4,0,15|t++3322++claw,C79C6E,5,0,15|t++1582++melee,C79C6E,6,0,15&chtt=Hunter_MM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,18,13,9,8,7,7,5,5,3,1&chds=0,100&chco=C79C6E,C55D54,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=aimed_shot|piercing_shots|steady_shot|chimera_shot|ranged|aimed_shot_mm|wild_quiver_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7pYjxighjfsurilldhiiffggacfjfcfhcdghfefhggklhkljlljllkkihdddcbaaccbbbccbaabbbaaabbaaabbbbbbbbbcddeeeeeedddeeedeeeeeeeeeeeeeeeeeddeeeeeeddddddddddddddddddddddddddeeeeeeeeeeeeeeefeeeeefffgggffeeeeeeedddddddddddddddddddeddddYVXchjkkjjhcYXadgijjihebZbehijhhihfcaaabdfhigdbaabceghhfcbbbcdfhihfcbbbcefhihfdbbcdegiihecbccdfgiihedccdegijjhedcdefhjjigedddeghjjhfeddefgiiihgfeefgikkjhfeeeefhijigeeeefhijjigffffghjjjigfffghikkjhdZadjoqpmkifcbeimoonlifbbfknonljhf&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:00z004244434685443100zyzyxuvttsrsrrrrrrssssssssssssssssrrqqppoonmllkjjihhgggffeeeeddddccccccbbbbaaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZaaaaaaaabbbbbbbbbbbbbbbbbaaaaaaZZZZZYYYYYYYYYYYZaaaabbccdefgghhhijjjkkllllllllkjjjiiihhgfeedcccbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZZZZZZZZaaaaaaaaaaaaaabbbbbbccccddeeeeffffffggghhhhhhgggfgggghghg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31639|max=62302&chxp=1,1,51,100&chtt=Hunter_MM_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,4,3,8,15,30,27,43,50,73,102,164,185,257,273,356,398,448,500,547,627,628,621,608,577,540,507,419,414,322,286,215,192,130,121,71,62,51,38,27,18,12,10,5,5,3,2,0,3&chds=0,628&chbh=5&chxt=x&chxl=0:|min=28800|avg=31639|max=34876&chxp=0,1,47,100&chtt=Hunter_MM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372 31639
aimed_shot 7631 24.1% 77.1 5.87sec 44732 22363 27697 59056 70452 54.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.15 76.99 0.00 0.00 2.0003 0.0000 3450990
Direct Results Count Pct Average Min Max Total Damage
hit 34.9 45.38% 27697.38 26825 34200 967542
crit 42.1 54.62% 59055.77 55260 70452 2483449

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2158 6.8% 23.4 18.83sec 41694 0 28033 58353 71552 45.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.40 23.36 0.00 0.00 0.0000 0.0000 975728
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 54.69% 28033.40 27244 34734 358113
crit 10.6 45.31% 58352.62 56123 71552 617616

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
chimera_shot 2882 9.1% 35.9 10.58sec 36316 35864 26235 54142 61279 36.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.88 35.79 0.00 0.00 1.0126 0.0000 1303185
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 63.52% 26235.36 25522 29747 596393
crit 13.1 36.48% 54142.47 52576 61279 706792

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 398 1.3% 8.7 10.61sec 20635 20407 15056 31011 34397 36.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.73 8.64 0.00 0.00 1.0112 0.0000 180213
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.61% 15055.82 14794 16697 82724
crit 3.1 36.39% 31010.72 30476 34397 97488

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 5736 18.1% 160.8 2.80sec 16130 0 0 0 0 0.0% 0.0% 0.0% 0.0% 363 7150 0 0.0% 0.0% 80.2%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
160.83 160.83 362.80 362.80 0.0000 1.0000 2594167
Direct Results Count Pct Average Min Max Total Damage
hit 160.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 362.8 100.00% 7150.47 816 35143 2594167

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:4942.68
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 2596 8.2% 146.8 3.09sec 7998 4498 5732 11863 13905 37.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.77 146.77 0.00 0.00 1.7782 0.0000 1173871
Direct Results Count Pct Average Min Max Total Damage
hit 92.5 63.04% 5732.29 5550 6750 530361
crit 54.2 36.96% 11863.07 11432 13905 643510

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 818 2.6% 1.4 97.30sec 261005 258662 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2418 3742 40.7% 0.0% 82.9%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.42 1.42 125.04 125.04 1.0091 3.0000 369765
Direct Results Count Pct Average Min Max Total Damage
hit 1.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 74.1 59.30% 2418.29 2353 2717 179299
crit 50.9 40.70% 3742.38 3635 4198 190467

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4069 12.9% 208.1 2.16sec 8841 7407 5919 12353 14446 45.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
208.14 207.76 0.00 0.00 1.1936 0.0000 1840239
Direct Results Count Pct Average Min Max Total Damage
hit 112.9 54.33% 5918.95 5786 7013 668068
crit 94.9 45.67% 12353.26 11919 14446 1172171

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2062 6.5% 121.8 3.69sec 7657 0 5586 11217 13159 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.81 121.81 0.00 0.00 0.0000 0.0000 932733
Direct Results Count Pct Average Min Max Total Damage
hit 77.0 63.23% 5586.33 5420 6580 430253
crit 44.8 36.77% 11217.31 10840 13159 502479

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3290
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1709 51.9% 151.3 3.00sec 5106 3322 3354 6776 10441 51.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.29 151.29 0.00 0.00 1.5370 0.0000 772452
Direct Results Count Pct Average Min Max Total Damage
hit 73.8 48.81% 3354.28 1767 5220 247691
crit 77.4 51.19% 6775.89 3535 10441 524761

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1582 48.1% 384.5 1.17sec 1860 1582 1275 2565 3174 51.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
384.51 384.51 0.00 0.00 1.1754 0.0000 715067
Direct Results Count Pct Average Min Max Total Damage
hit 95.5 24.83% 1274.78 1181 1587 121726
crit 196.8 51.17% 2565.29 2361 3174 504769
glance 92.3 23.99% 960.06 885 1190 88572

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372
aimed_shot focus 68.5% 981.4 46
chimera_shot focus 30.8% 825.4 44
serpent_sting focus 0.7% 10440.2 25
pet - cat
claw focus 100.0% 184.4 28
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.6 2353.2 1.3 2.8%
glyph_aimed_shot focus 52.7 260.9 4.9 1.0%
rapid_recuperation focus 312.3 339.2 1.1 6.0%
steady_shot focus 208.1 2132.7 10.2 0.2%
pet - cat focus
focus_regen focus 1809.6 3661.3 2.0 13.5%
go_for_the_throat focus 54.2 469.2 8.7 13.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.8 67.7 46.8sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.8sec 55.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.1 68.4 42.9sec 5.7sec 95% 95%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.2 94.9 18.8sec 3.8sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.5 0.0 18.8sec 18.8sec 5% 5%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.4sec 86.4sec 17% 18%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.6sec 222.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 57.7sec 57.7sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.8 67.7 46.8sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 237.3 45.0sec 1.8sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.2 6.5 9.7sec 8.5sec 16% 30%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 121.8 3.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.58%
σ of the average dps 7.9845
2 * σ / μ 0.0505%
95% Confidence Intervall ( μ ± 2σ ) ( 31623.15 - 31655.09 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31615.16 - 31663.07 )
Sample Data
σ 798.4504
Minimum 28800.36
Maximum 34875.62
Spread ( max - min ) 6075.27
Range ( max - min ) / 2 3037.63
Range% 9.60
10th Percentile 30643.79
90th Percentile 32672.92
( 90th Percentile - 10th Percentile ) 2029.13
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2547
0.1 scale factor error with delta=300 5666
0.05 scale factor error with delta=300 22667
0.01 scale factor error with delta=300 566687
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
M steady_shot

Sample Sequence

0134568AGHL6L6MIL6ML6ML6MIL6L6ML6MILL6MML6MMMLL6ML6MIML6MML6GKL6L6MIL6MML6ML6MML6KL6L6MIML6MML6MML6MMLL6MML6MMML6MEMIFMMMLMML6MFMIL6MMMMFML6MIMKMFMIL6MMMMFL6MMMKMMFL6MMMMMKFL6MIMMML6FMIMLAMML6MFMML6MMMKML6FMIML6KMIFL6MMMMML6FMIGH5FKML6MIL6MML6MFMGML6MML6ML6MFLMIL6MMML6MFMIML6KMIL6FMMML6MMMMFKML6MIMMFML6MIMMMFKL6MIMMMFLL6MIMMMFL6MIMMML6FMILMMML6FMIML6MMMMFML6AMMMKMMFL6MMMMKL6MFMIML6MMMFMML6MMMMFLL6MIMMMFL6MIMGHFKL6MIL6L6MMFML6MGL6MIL6LL6FJMIL6L6ML6MIFJMML6MMMFJKL6MIML6FJMIL6MMMFJML6KMIL6FJMIL6MMMFJL6MIMMKL6FJMIL6MMMFJML6MIMKFJL6AMIML6MF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8471 5822 5345
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.43% 12.43% 2229
Spell Haste 16.28% 10.75% 1376
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20914 11984 190
Melee Hit 8.04% 8.04% 966
Melee Crit 41.98% 28.82% 2229
Melee Haste 14.07% 10.75% 1376
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.12% 6.89% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 2
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 2
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372
origin="http://chardev.org/?profile=34117"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
glyphs=steady_shot/aimed_shot/rapid_fire
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2229
# gear_haste_rating=1376
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372_Arcane : 31051dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31050.5 13.60 / 0.04% 2913.2 10.7 10.5 focus 0.00% 59.1
Origin http://chardev.org/?profile=34115
Talents http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
Glyphs
  • steady_shot
  • rapid_fire
  • arcane_shot

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:36153|24666|20470|13055|7374|4314|3612|1689&chds=0,72305&chco=336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++36153++chimera_shot,336600,0,0,15|t++24666++aimed_shot,C79C6E,1,0,15|t++20470++kill_shot,C79C6E,2,0,15|t++13055++arcane_shot,69CCF0,3,0,15|t++7374++steady_shot,C79C6E,4,0,15|t++4314++ranged,C79C6E,5,0,15|t++3612++claw,C79C6E,6,0,15|t++1689++melee,C79C6E,7,0,15&chtt=Hunter_MM_T11_372_Arcane+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:15,14,14,11,9,8,7,6,6,5,3,1&chds=0,100&chco=C55D54,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,336600,C79C6E&chl=piercing_shots|aimed_shot|steady_shot|ranged|chimera_shot|wild_quiver_shot|aimed_shot_mm|arcane_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372_Arcane+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7nSdranVjYfrjogeggffdcfcZageYaegcbbdfcabhigjlhijhhjihjhcccccaYYYZYXWXXYXWVVWWVVUVVVUUUUUUUUUUUUUUUUUUVVUUTTTUUUUUVUUTTUUUUUUUUTTTUUUUUUUUTTTTUUUUUUTTTTUUUUUUUUUUUUVVVVVVVVVVVVVVVUVZccaWVWXXXURSUVUTRQQRSTVWWVTSRRSTVWXWUSRUUSUbhihjihheYWXaehiiihfcZZbehhdabbYUQOOPSWZbaWSPNOQUYbbZUQONPSWacbXTPNOQTYbcZVROOPSWZcbYTQOOQUYbcaWSPOQTXbdcZURPPRUYbcbXTQPQSWZccZVRPPRUYbcddaZYWWZccZVUVUSQPQSUWYYXVTRSTVXZaZXUTSTVXZaaYWUTTUWYaaaaXWYcinpnkigcZZbfilmljhebacfillidbZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372_Arcane+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:zz1y2033444578544321110z0xyvutsrsrrrrrrrrrrrrrrrrrrrrrrqqppponnmllkjjiihhggffffeeeeddddcccccbbbbbaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZYYYYYYYYYYYZaaaabbbcddegghhhiijjjkklmllllllkjjjiihhgffeddccbbaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZYYYZZZZZZZZZZZaaaaaaaaaaaaaaaaZZZZZZZZZZaaaaaaaaaaaaaaaaaaabbbbbbbccdddeeeeefffggghhhhhgggfggghhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31051|max=61447&chxp=1,1,51,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,3,4,11,22,32,37,53,89,137,173,195,234,302,380,425,527,588,641,618,654,609,646,621,491,469,430,365,257,237,181,148,111,98,59,53,25,26,12,17,7,5,3,1,1,0,0,0,1&chds=0,654&chbh=5&chxt=x&chxl=0:|min=28680|avg=31051|max=34131&chxp=0,1,43,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372_Arcane 31051
aimed_shot 4196 13.5% 37.1 11.49sec 51150 24666 28314 60345 70327 71.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.10 37.04 0.00 0.00 2.0737 0.0000 1897555
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 28.46% 28314.13 26771 34139 298527
crit 26.5 71.54% 60345.24 55149 70327 1599028

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2195 7.1% 23.6 18.69sec 41971 0 27988 58317 71426 46.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.65 23.60 0.00 0.00 0.0000 0.0000 992473
Direct Results Count Pct Average Min Max Total Damage
hit 12.6 53.60% 27987.82 27189 34673 353954
crit 10.9 46.40% 58317.03 56010 71426 638519

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
arcane_shot 1985 6.4% 68.4 5.41sec 13121 13055 9469 19503 21283 36.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.41 68.24 0.00 0.00 1.0050 0.0000 897542
Direct Results Count Pct Average Min Max Total Damage
hit 43.2 63.29% 9469.45 9291 10332 408932
crit 25.1 36.71% 19502.79 19140 21283 488609

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
chimera_shot 2892 9.3% 36.0 10.55sec 36375 36153 26188 54021 61176 37.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.96 35.86 0.00 0.00 1.0062 0.0000 1307898
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 63.04% 26187.87 25473 29697 591940
crit 13.3 36.96% 54021.11 52474 61176 715958

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 404 1.3% 8.9 10.50sec 20619 20470 15033 30967 34332 36.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.87 8.75 0.00 0.00 1.0073 0.0000 182821
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.27% 15033.36 14766 16666 83256
crit 3.2 36.73% 30966.89 30419 34332 99565

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 4776 15.4% 150.1 3.00sec 14393 0 0 0 0 0.0% 0.0% 0.0% 0.0% 358 6031 0 0.0% 0.0% 79.2%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.07 150.07 358.15 358.15 0.0000 1.0000 2159902
Direct Results Count Pct Average Min Max Total Damage
hit 150.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 358.2 100.00% 6030.67 815 33627 2159902

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:6951.74
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 3548 11.4% 201.5 2.25sec 7964 4314 5704 11792 13885 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
201.46 201.46 0.00 0.00 1.8460 0.0000 1604416
Direct Results Count Pct Average Min Max Total Damage
hit 126.7 62.88% 5704.24 5541 6740 722605
crit 74.8 37.12% 11792.23 11414 13885 881810

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 816 2.6% 1.8 126.82sec 210345 208923 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2414 3735 41.0% 0.0% 82.8%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.75 1.75 124.85 124.85 1.0068 3.0000 369092
Direct Results Count Pct Average Min Max Total Damage
hit 1.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.6 58.97% 2414.06 2349 2713 177721
crit 51.2 41.03% 3735.35 3629 4191 191371

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4192 13.5% 213.2 2.11sec 8892 7374 5913 12343 14426 46.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
213.20 212.81 0.00 0.00 1.2058 0.0000 1895851
Direct Results Count Pct Average Min Max Total Damage
hit 113.7 53.41% 5912.70 5777 7003 672056
crit 99.2 46.59% 12342.79 11901 14426 1223795

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2503 8.1% 147.8 3.05sec 7658 0 5570 11179 13141 37.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
147.80 147.80 0.00 0.00 0.0000 0.0000 1131793
Direct Results Count Pct Average Min Max Total Damage
hit 92.8 62.78% 5570.14 5412 6570 516828
crit 55.0 37.22% 11178.56 10823 13141 614965

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3546
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1858 52.4% 151.3 3.00sec 5551 3612 3644 7340 10421 51.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.29 151.29 0.00 0.00 1.5370 0.0000 839846
Direct Results Count Pct Average Min Max Total Damage
hit 73.2 48.40% 3643.98 1764 5211 266811
crit 78.1 51.60% 7340.05 3527 10421 573035

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1689 47.6% 410.1 1.10sec 1862 1689 1273 2561 3168 51.6% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
410.10 410.10 0.00 0.00 1.1021 0.0000 763502
Direct Results Count Pct Average Min Max Total Damage
hit 100.3 24.46% 1272.78 1178 1584 127679
crit 211.5 51.56% 2561.03 2356 3168 541579
glance 98.3 23.97% 958.56 884 1188 94244

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372_Arcane
aimed_shot focus 35.1% 1123.1 46
arcane_shot focus 31.2% 596.4 22
chimera_shot focus 32.8% 826.7 44
serpent_sting focus 0.9% 8413.8 25
pet - cat
claw focus 100.0% 202.2 27
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.6 2356.6 1.3 1.2%
rapid_recuperation focus 312.7 345.6 1.1 3.8%
steady_shot focus 213.2 2058.5 9.7 0.0%
pet - cat focus
focus_regen focus 1809.6 3473.4 1.9 16.7%
go_for_the_throat focus 74.8 631.2 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.7 68.4 47.4sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.0sec 55.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.5 68.9 41.2sec 5.6sec 96% 97%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.4 95.9 18.6sec 3.7sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.7 0.0 18.7sec 18.7sec 7% 7%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.1 0.0 80.1sec 80.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 17%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.2sec 222.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.0sec 55.0sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.7 68.4 47.4sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 248.7 45.0sec 1.7sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 56.0 6.6 8.0sec 7.2sec 20% 37%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 147.8 3.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.55%
σ of the average dps 6.7994
2 * σ / μ 0.0438%
95% Confidence Intervall ( μ ± 2σ ) ( 31036.94 - 31064.14 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31030.14 - 31070.94 )
Sample Data
σ 679.9438
Minimum 28680.47
Maximum 34130.70
Spread ( max - min ) 5450.23
Range ( max - min ) / 2 2725.11
Range% 8.78
10th Percentile 30209.53
90th Percentile 31945.94
( 90th Percentile - 10th Percentile ) 1736.41
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1918
0.1 scale factor error with delta=300 4109
0.05 scale factor error with delta=300 16438
0.01 scale factor error with delta=300 410954
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
M arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
N steady_shot

Sample Sequence

0134568AGHL6L6NIL6NL6NL6NIL6LL6L6NINL6NNNL6KL6NIL6NNL6NNNL6GNNL6KL6NL6NIL6NL6NNL6NNL6KL6NIL6NNNL6NNNL6NNL6KL6NIL6NENINFKNMNINNMFNMNINNKMFMNIMNNNNFMNMNINKMFNIMNNNMNFKMNINNMNMFNIMMNNNKNFMNIMANNL6NNFLNNMNNNMFNMNINNMKFNMNINNMNFMNGH5IFLNL6NIL6NL6NIFGNNL6NL6NNL6NFNNL6NNMKNMFNIMMNNNNFKMNMNINNFMNMNIKNNFMNMNINKMFNIMNNNMNFMNIMNKNNFMNMNINNMNFKMNINNMNFMNIMNNNKFMNIMNNAL6NNFNNNLL6NINFMNMNINNMFKNMNINNMFNMNINNKMNFMNIMNNMNFGHFNIL6NNL6KL6FNIL6GNNL6NJLFL6NIL6NL6JNIFNMNMNIJNFMKMNINJMNFMNIMNNJMNFMNIMNJNKFMMNINJMNFMNIMNJKNFMNIMNJNMFNIMMNJNIFKMANNL6JN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8449 5801 5325
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20860 11942 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.34% 29.18% 2305
Melee Haste 12.35% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.08% 6.84% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.96% 11.96% 710

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 1
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 1
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 2
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372_Arcane
origin="http://chardev.org/?profile=34115"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
glyphs=steady_shot/rapid_fire/arcane_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5325
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=710
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_SV_T11_372 : 26514dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26514.3 7.33 / 0.03% 2620.7 10.1 10.0 focus 0.00% 51.1
Origin http://chardev.org/?profile=34116
Talents http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
Glyphs
  • arcane_shot
  • explosive_shot
  • kill_shot

Charts

http://8.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:34048|31817|28148|17490|11646|3997|3847|1429|901&chds=0,68096&chco=C41F3B,9482C9,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++34048++explosive_shot,C41F3B,0,0,15|t++31817++black_arrow,9482C9,1,0,15|t++28148++kill_shot,C79C6E,2,0,15|t++17490++arcane_shot,69CCF0,3,0,15|t++11646++cobra_shot,336600,4,0,15|t++3997++claw,C79C6E,5,0,15|t++3847++ranged,C79C6E,6,0,15|t++1429++melee,C79C6E,7,0,15|t++901++wolverine_bite,C79C6E,8,0,15&chtt=Hunter_SV_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:28,23,14,7,7,6,5,5,4,1,0&chds=0,100&chco=336600,C41F3B,C79C6E,C79C6E,69CCF0,336600,C79C6E,9482C9,C79C6E,C79C6E,336600&chl=cobra_shot|explosive_shot|ranged|claw|arcane_shot|serpent_sting|melee|black_arrow|kill_shot|wolverine_bite|serpent_sting_burst&chtt=Hunter_SV_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yuXYo04mnz677uu2323upuwwyxiZYZgqnnsvvyyqswuwyruzzy0sjgggimnorsrsttuuttttttsplfbZabdhknqstuvwwwvuuuutrmieccdfhkmpqssttuuutttssqmhecbbdfhkmoqsttttuuttsrpmjgdccdfhknpqstuvvuuuutsqnkigffghjlnprsttuuuuuttrpnkifedefhjlnpqrsttttttssrponlmmnprssttuuuuttuuttrqomkiggghjlnoqrstuuuutttsqoljhgffghikmopqsstttttsrqomllmllmopsttuvvvvutttssrpnkihggghiklnpqrsttttttsrpnljhgggghiklnoqrrssttsrqpnlkihgfggijkmnpqrssttssrqonlkjkkloqrtvvwwwwvvuutsqpnljihggghiklnopqrsssssrq&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Hunter_SV_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:22333464444467765422zyxxwwvtuutstsrrrrrrrrqqpoonnnmmmmmmmnnnmnnnononnmmmlllkkkkkkkkkkkkklllllkkkjjjjjjjijijjjjjjjjkkklkkkkkjkjjjjjjjjjjjjjjjkjjjjjiiiiihihiiiiiijjjjkkkkkkkkkkkkkjkjjkjkkkkkkkkkkkjjjjjiiiiiiihiiiiiiijjjjjjjjjijijjjjjjjjkjkkkklllllllllklkkkkkkkkkkkkkkkkkkkkkjjjjjjjjijjjjjjjjjkkkkkkllllmmmnnoopooppppppppooonnnmmllllllllmmmmmmnnnnnnnnnmmmmmmmmmmmnnnnnnnoonnonnnnmnnmmmmmmmmmmmnnnnnnnnnnnnnnonnoooooppppppppppppppooooooooooooopppppppppqqpq&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26514|max=40881&chxp=1,1,65,100&chtt=Hunter_SV_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,4,5,9,14,33,35,71,78,86,133,165,226,284,371,426,487,526,519,571,592,631,563,594,548,521,433,406,328,281,234,189,162,121,95,73,46,39,30,16,15,11,12,4,4,1,0,0,3&chds=0,631&chbh=5&chxt=x&chxl=0:|min=25268|avg=26514|max=28042&chxp=0,1,45,100&chtt=Hunter_SV_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_SV_T11_372 26514
arcane_shot 1784 6.7% 45.9 9.71sec 17585 17490 12471 25810 29416 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.87 45.81 0.00 0.00 1.0054 0.0000 806689
Direct Results Count Pct Average Min Max Total Damage
hit 28.2 61.49% 12470.79 12080 14280 351317
crit 17.6 38.51% 25810.21 24885 29416 455372

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 1299 4.9% 18.4 25.22sec 31989 31817 0 0 0 0.0% 0.0% 0.0% 0.0% 90 4611 9674 38.1% 0.0% 59.6%

Stats details: black_arrow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.36 18.33 89.81 89.81 1.0054 3.0000 587419
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 55.6 61.88% 4610.80 4458 5425 256245
crit 34.2 38.12% 9673.67 9317 11339 331174

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $o1 Shadow damage over $d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.095000
  • base_td:407.33
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
cobra_shot 7475 28.2% 210.4 2.14sec 16070 11646 10636 22109 25195 47.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.35 209.97 0.00 0.00 1.3799 0.0000 3380324
Direct Results Count Pct Average Min Max Total Damage
hit 110.0 52.39% 10636.44 10408 12231 1170052
crit 100.0 47.61% 22109.17 21440 25195 2210272

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
explosive_shot 6120 23.1% 80.8 5.62sec 34250 34048 0 0 0 0.0% 0.0% 0.0% 0.0% 240 7777 16320 44.2% 0.0% 35.1%

Stats details: explosive_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
80.81 80.64 239.53 239.53 1.0059 0.6633 2767890
Direct Results Count Pct Average Min Max Total Damage
hit 80.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.6 55.77% 7776.76 7501 9310 1038836
crit 105.9 44.23% 16320.36 15678 19458 1729054

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:Taking $w1 Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing $ Fire damage. The charge will blast the target every second for an additional $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.232000
  • base_td:353.32
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
kill_shot 946 3.6% 15.1 5.87sec 28308 28148 18195 37654 43151 53.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.11 14.94 0.00 0.00 1.0057 0.0000 427780
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 46.33% 18194.75 17321 20947 125915
crit 8.0 53.67% 37654.11 35682 43151 301865

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 3840 14.5% 207.4 2.19sec 8373 3847 5942 12290 14027 38.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
207.38 207.38 0.00 0.00 2.1765 0.0000 1736482
Direct Results Count Pct Average Min Max Total Damage
hit 127.9 61.70% 5941.73 5765 6809 760234
crit 79.4 38.30% 12290.14 11876 14027 976248

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1678 6.3% 1.0 0.00sec 759030 731937 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3137 6577 53.2% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 150.02 150.02 1.0370 3.0000 745114
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 70.2 46.81% 3137.00 3047 3676 220312
crit 79.8 53.19% 6577.47 6369 7682 524802

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
serpent_sting_burst 15 0.1% 1.0 0.00sec 6958 0 4834 9959 9959 41.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 6958
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 58.56% 4834.42 4834 4834 2831
crit 0.4 41.44% 9958.90 9959 9959 4127

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3903.54
  • base_dd_max:3903.54
pet - wind_serpent 3389
claw 1826 53.9% 134.4 3.36sec 6143 3997 4237 8522 12431 44.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.38 134.38 0.00 0.00 1.5370 0.0000 825530
Direct Results Count Pct Average Min Max Total Damage
hit 74.6 55.51% 4236.51 1978 6215 316018
crit 59.8 44.49% 8522.00 3955 12431 509513

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
lightning_breath 0 0.0% 15.5 30.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_breath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.47 15.47 0.00 0.00 1.4626 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.5 100.00% 0.00 0 0 0

Action details: lightning_breath

Static Values
  • id:24844
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases magic damage taken by $s2%.
  • description:Breathes lightning, increasing magic damage taken by $s2% for $d.
melee 1428 42.1% 322.0 1.40sec 2005 1429 1442 2899 3779 44.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
321.99 321.99 0.00 0.00 1.4032 0.0000 645653
Direct Results Count Pct Average Min Max Total Damage
hit 101.3 31.47% 1441.65 1321 1889 146062
crit 143.4 44.54% 2899.22 2643 3779 415776
glance 77.3 24.00% 1084.71 991 1417 83815

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
roar_of_recovery 0 0.0% 2.7 181.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_recovery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: roar_of_recovery

Static Values
  • id:53517
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1 focus every $t1 sec.
  • description:Your pet's inspiring roar restores $o1 focus over $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
wolverine_bite 135 4.0% 45.1 10.08sec 1352 901 933 1873 2471 44.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolverine_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.12 45.12 0.00 0.00 1.4992 0.0000 60984
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 55.45% 932.62 851 1236 23335
crit 20.1 44.55% 1872.89 1701 2471 37649

Action details: wolverine_bite

Static Values
  • id:53508
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A fierce attack causing $ damage, that your pet can use after it makes a critical attack. Cannot be dodged, blocked or parried.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1.00
  • base_dd_max:1.00

Resources

Resource Usage Type Res% DPR RPE
Hunter_SV_T11_372
arcane_shot focus 22.1% 799.3 22
black_arrow focus 14.0% 914.0 35
explosive_shot focus 63.3% 954.9 36
serpent_sting focus 0.5% 30361.2 25
pet - wind_serpent
claw focus 100.0% 222.2 28
Resource Gains Type Count focus Average Overflow
cobra_shot focus 210.4 1887.8 9.0 0.3%
focus_regen focus 1809.6 2244.9 1.2 0.6%
roar_of_recovery focus 8.2 80.9 9.9 0.8%
thrill_of_the_hunt focus 21.8 306.8 14.1 2.0%
pet - wind_serpent focus
focus_regen focus 1809.6 3020.9 1.7 15.9%
go_for_the_throat focus 79.4 649.5 8.2 18.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
culling_the_herd 18.3 41.5 24.9sec 7.5sec 82% 81%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.5sec 57.5sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
lock_and_load 7.5 0.0 56.7sec 56.7sec 5% 12%

Database details

  • id:56453
  • cooldown name:buff_lock_and_load
  • tooltip:Your next Arcane Shot or Explosive Shot spells trigger no cooldown and cost no focus.
  • max_stacks:2
  • duration:12.00
  • cooldown:22.00
  • default_chance:12.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.6sec 300.6sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.9sec 394.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 58.2sec 58.2sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
wind_serpent-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 6%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-culling_the_herd 18.3 41.5 24.9sec 7.5sec 82% 78%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-owls_focus 40.3 0.0 11.0sec 11.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_owls_focus
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:30.00%
wind_serpent-sic_em 17.2 0.5 25.2sec 24.5sec 7% 13%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-wolverine_bite 46.1 177.2 9.9sec 2.0sec 89% 100%

Database details

  • id:
  • cooldown name:buff_wolverine_bite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sniper_training

Database details

  • id:64420
  • cooldown name:buff_sniper_training
  • tooltip:Damage done by your Steady Shot and Cobra Shot increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:300.00%

Uptimes

%

Procs

Count Interval
lock_and_load 7.5 56.7sec
thrill_of_the_hunt 21.8 19.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.80%
σ of the average dps 3.6665
2 * σ / μ 0.0277%
95% Confidence Intervall ( μ ± 2σ ) ( 26507.01 - 26521.68 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26503.34 - 26525.34 )
Sample Data
σ 366.6506
Minimum 25267.81
Maximum 28041.91
Spread ( max - min ) 2774.10
Range ( max - min ) / 2 1387.05
Range% 5.23
10th Percentile 26071.71
90th Percentile 27002.00
( 90th Percentile - 10th Percentile ) 930.30
Approx. Iterations needed for
1% dps error 7
0.1% dps error 764
0.1 scale factor error with delta=300 1194
0.05 scale factor error with delta=300 4779
0.01 scale factor error with delta=300 119495
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B multi_shot,if=target.adds>2
C cobra_shot,if=target.adds>2
D serpent_sting,if=!ticking
E rapid_fire
F explosive_shot,non_consecutive=1
G black_arrow,if=!ticking
H kill_shot
I arcane_shot,if=focus>=70&buff.lock_and_load.down
J cobra_shot

Sample Sequence

0134579DEFGJJJFJFIFJIJIJFJJIJIFJJIGJFJJJJJFJJIJIFJJJIFJGJJFJJJJFJFJFIFJJJIFJJGJJFJJJJFJJJIJFJIJIJFJGJJFJJJIFJJ9JJFJJIJFGJJJFJJJFJFIFJIJIJFJGJJFJJJJFJFJFIFJJJJFGJJJFJJJJFJFJFIFJJJGFJJJIFJJJIFJJJJFJJGJFJJIFJFI9FJJIJFJJIJGFJJJJFJJIJFJJJIFJJJGJFJFJFIFJJJJFJJIJEFJGJJJFJJIJIFJJJIFJFIFJJGJFJJJJFJJIJIFJJJIFJJGJJFJJ9JIFJFIFJJIJFJJGJFJJJJFJIJIJFJJJIFJGJJJFJFJFIFJJIJFJJJGFJJJJFJJHHIFJFIFJJHHIFGJJJFJHHJJFJJIJFHHJIGJ9FJJJH4FHJJFJFIFJHHIIFJJGJJFHHJJJFJJFJFHFHJIJGJFJJHHJFJJJ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 9526 6553 5367
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.07% 12.07% 2164
Spell Haste 16.68% 11.13% 1425
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 21332 13445 190
Melee Hit 8.04% 8.04% 966
Melee Crit 44.86% 30.71% 2164
Melee Haste 14.46% 11.13% 1425
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 14.07% 8.30% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.32% 11.32% 596

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 0
Bestial Discipline 1
Pathfinding 0
Spirit Bond 0
Frenzy 0
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 2
Survival Tactics 2
Trap Mastery 3
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 3
Counterattack 0
Lock and Load 2
Resourcefulness 3
Mirrored Blades 0
T.N.T. 2
Toxicology 2
Wyvern Sting 1
Noxious Stings 2
Hunting Party 1
Sniper Training 3
Serpent Spread 1
Black Arrow 1

Profile

#!./simc

hunter=Hunter_SV_T11_372
origin="http://chardev.org/?profile=34116"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
glyphs=arcane_shot/explosive_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking
actions+=/rapid_fire
actions+=/explosive_shot,non_consecutive=1
actions+=/black_arrow,if=!ticking
actions+=/kill_shot
actions+=/arcane_shot,if=focus>=70&buff.lock_and_load.down
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=5367
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2164
# gear_haste_rating=1425
# gear_mastery_rating=596
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=wind_serpent

Mage_Arcane_T11_372 : 28713dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28713.2 16.05 / 0.06% 13.7 2097.0 1890.0 mana 0.00% 176.0
Origin http://chardev.org/?profile=35357
Talents http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
Glyphs
  • evocation
  • arcane_power
  • slow
  • mirror_image
  • arcane_brilliance
  • conjuring
  • arcane_blast
  • arcane_missiles
  • mage_armor

Charts

http://7.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:41519|32283|17163|15238|1484&chds=0,83038&chco=C41F3B,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++41519++flame_orb,C41F3B,0,0,15|t++32283++arcane_blast,69CCF0,1,0,15|t++17163++arcane_barrage,69CCF0,2,0,15|t++15238++arcane_missiles,69CCF0,3,0,15|t++1484++mirror_arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:88,6,3,2,0,0&chds=0,100&chco=69CCF0,69CCF0,C41F3B,69CCF0,69CCF0,C41F3B&chl=arcane_blast|arcane_missiles|flame_orb_tick|mirror_arcane_blast|arcane_barrage|ignite&chtt=Mage_Arcane_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7876431zywvtrqonmlkihfecbZYWUTRQPOOORWcjqvyzzzzyyxxyzzzzzzyyxyyzz000zyyyzzz00zzyyyyzzzzzzyxwxxyyyyyxxxxxyyyyyyxxxyyyzzzz22221zyxwutsrqponnmlkjjihgfeedcbaZYYXWVUTTSRRQQRSVXbfjorvxz001111100000000z00000000zz0000000zzzzzz00000zzz0000000zzzz00000z000000000000zzyxwvutrqponmlkjigfedcbaZYXXWVUTTSRRQQQRSUWZdhloruwyzz0011111000000zzzzzzyyyyyyyxxxxxxwwwwwvvvvvuuuuttttssssrrrrrrrrrrrrssssssssrrqqpponmmlkjiihgffeddcbaaZYYXWVVUTTSRRRRRRSSTUUVWXYZbcdefghhhiijjk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=126644&chtt=Mage_Arcane_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:567787654332432zxvtsqonligdbZXVTSQQPOONNMLKKJJKLMNOOOPPPQRQRRRRSSSSSSSRRRRSSRRRRRRRRRRRRRQRRRRRRRRRRRQPQQQQQQQRRRSUWYZbcefhijlmmmnnnnnnlkihgedbaZYXXWWWWVVVUUTTSRQPONMLKKJJIIIIIJJKKLMNOPQRSSTTUUVUUUUTTTSSSRRRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRSSTTUVVWXXZaabcccdeeeeeeeddccbbaZZYYXXWVTSSRQPONMLKKJJIIIIIIIJJKLLMNOPQQRRSSSSSSSSSSSSSSRRRRRRRRRSSSSSSSSSSSSTTTTTTTTUUUUUUVVVWXXXYYZZabcdeefggghhhhhgggffedccbaZZYYXXWVVVUTTSSSRRQQQPPPOOOOOOOOOOOOPPPPPPPQQQQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28713|max=79282&chxp=1,1,36,100&chtt=Mage_Arcane_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,1,4,4,15,18,23,29,61,94,113,149,199,255,301,361,438,489,530,577,590,564,591,532,539,501,486,434,347,325,270,243,203,144,106,123,90,70,42,41,30,17,16,8,9,5,3,3,3&chds=0,591&chbh=5&chxt=x&chxl=0:|min=25996|avg=28713|max=31836&chxp=0,1,47,100&chtt=Mage_Arcane_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Arcane_T11_372 28713
arcane_barrage 129 0.4% 2.7 86.17sec 21472 17163 16186 33172 40026 32.7% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.72 2.71 0.00 0.00 1.2511 0.0000 58390
Direct Results Count Pct Average Min Max Total Damage
hit 1.8 65.95% 16185.79 12603 19667 28973
crit 0.9 32.67% 33172.28 25891 40026 29417
miss 0.0 1.38% 0.00 0 0 0

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1915.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.803000
  • base_dd_min:1054.50
  • base_dd_max:1288.83
arcane_blast 25356 88.3% 261.3 1.73sec 43857 32283 33433 68790 136493 30.8% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.34 261.34 0.00 0.00 1.3585 0.0000 11461628
Direct Results Count Pct Average Min Max Total Damage
hit 177.4 67.88% 33432.96 17143 66411 5930462
crit 80.4 30.77% 68789.69 35180 136493 5531166
miss 3.5 1.36% 0.00 0 0 0

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:870.7
  • cooldown:0.00
  • base_execute_time:2.12
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $s1 Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1%, the casting time is reduced by ${$36032m3/-1000}.1 sec and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.057000
  • base_dd_min:1764.41
  • base_dd_max:2050.53
arcane_missiles 1632 5.7% 21.3 17.42sec 34689 15238 0 0 0 0.0% 0.0% 0.0% 0.0% 106 4963 10196 40.1% 1.4% 9.5%

Stats details: arcane_missiles

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.27 21.27 106.00 105.52 2.2764 0.4070 737917
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.8 58.57% 4962.63 3848 6144 306684
crit 42.3 40.08% 10196.10 7909 12644 431233
miss 1.4 1.35% 0.00 0 0 0

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches Arcane Missiles at the enemy, causing $7268s1 Arcane damage every $5143t2 sec for $5143d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.246000
  • base_dd_min:358.06
  • base_dd_max:358.06

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches $?[five]?[four][three] waves of Arcane Missiles at the enemy over $d, causing $7268s1 Arcane damage per wave. Each offensive spell you cast has a $79684h% chance to activate Arcane Missiles.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
arcane_power 0 0.0% 4.4 122.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.38 4.38 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.4 100.00% 0.00 0 0 0

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increased damage and mana cost for your spells.
  • description:When activated, you deal $s1% more spell damage but spells cost $s2% more mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
evocation 0 0.0% 3.4 131.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: evocation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.39 3.39 0.00 0.00 4.9012 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.4 100.00% 0.00 0 0 0

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1% of total mana every $t1 sec.
  • description:Gain $s1% of your mana instantly and another ${$m1*3}% of your total mana over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb 844 2.9% 7.7 61.20sec 49341 41519 0 0 0 0.0% 1.3% 0.0% 0.0% 114 0 0 0.0% 0.0% 25.3%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.73 7.73 114.17 0.00 1.1884 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.69% 0.00 0 0 0
miss 0.1 1.31% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_tick 844 2.9% 114.2 3.75sec 3341 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2535 5255 30.9% 1.4% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.17 0.00 0.00 114.17 0.0000 0.0000 381420
Tick Results Count Pct Average Min Max Total Damage
hit 77.3 67.70% 2534.81 1659 4228 195938
crit 35.3 30.92% 5254.54 3409 8689 185482
miss 1.6 1.38% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 107 0.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 50 972 0 0.0% 0.0% 22.1%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 32.04 49.95 49.95 0.0000 2.0000 48537
Direct Results Count Pct Average Min Max Total Damage
hit 32.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 49.9 100.00% 971.76 444 5425 48537

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:519.82
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
presence_of_mind 0 0.0% 5.5 91.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell.
pet - mirror_image_3 752
mirror_arcane_blast 752 100.0% 78.5 15.29sec 3711 1484 3607 5415 7616 9.8% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.48 78.48 0.00 0.00 2.5000 0.0000 291260
Direct Results Count Pct Average Min Max Total Damage
hit 69.2 88.17% 3606.70 2114 5078 249581
crit 7.7 9.81% 5415.34 3171 7616 41679
miss 1.6 2.02% 0.00 0 0 0

Action details: mirror_arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing ${($m1+$M1)/2} Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1% and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.275000
  • base_dd_min:224.56
  • base_dd_max:260.98

Resources

Resource Usage Type Res% DPR RPE
Mage_Arcane_T11_372
arcane_barrage mana 0.5% 13.4 1604
arcane_blast mana 96.5% 12.5 3502
conjure_mana_gem mana 1.3% 0.0 12634
flame_orb mana 0.6% 62.5 790
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 28774.9 15.9 2.5%
clearcasting none 24.8 18405.9 741.5 0.0%
evocation mana 13.6 236291.4 17428.7 0.2%
flask mana 1.0 4725.0 4725.0 0.0%
food mana 1.0 1417.5 1417.5 0.0%
initial_mana none 1.0 107548.4 107548.4 0.0%
mage_armor mana 1809.6 381223.6 210.7 2.5%
mana_gem mana 4.1 49849.9 12103.0 0.0%
master_of_elements mana 116.6 22092.8 189.5 0.7%
mp5_regen mana 1809.6 76859.3 42.5 2.4%
replenishment mana 1809.6 53088.7 29.3 2.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
arcane_blast 25.7 235.6 16.4sec 1.7sec 84% 98%

Database details

  • id:36032
  • cooldown name:buff_arcane_blast
  • tooltip:Arcane Blast damage increased by $w1%, casting time reduced by ${$m3/-1000}.1 sec and mana cost increased by $w2%.
  • max_stacks:4
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_missiles 22.2 98.4 18.7sec 3.8sec 71% 71%

Database details

  • id:79683
  • cooldown name:buff_arcane_missiles
  • tooltip:Arcane Missiles activated.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:40.00%
arcane_potency 28.6 1.8 16.1sec 15.1sec 19% 20%

Database details

  • id:
  • cooldown name:buff_arcane_potency
  • tooltip:(null)
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_power 4.4 0.0 122.1sec 122.1sec 14% 29%

Database details

  • id:12042
  • cooldown name:buff_arcane_power
  • tooltip:Increased damage and mana cost for your spells.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 179.7 81.4 2.5sec 1.7sec 81% 81%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 24.9 0.0 18.5sec 18.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
improved_mana_gem 4.1 0.0 127.3sec 127.3sec 13% 13%

Database details

  • id:
  • cooldown name:buff_improved_mana_gem
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.6 0.0 55.3sec 55.3sec 28% 28%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 9.4 0.0 50.4sec 50.4sec 25% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shard_of_woe 7.7 0.0 63.4sec 63.4sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shard_of_woe
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.4 0.0 114.5sec 114.5sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 120.7sec 120.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 75.8 189.3sec 5.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
focus_magic_feedback

Database details

  • id:
  • cooldown name:buff_focus_magic_feedback
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mage_armor

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
arcane_blast_0 9.8%
arcane_blast_1 9.4%
arcane_blast_2 9.2%
arcane_blast_3 9.0%
arcane_blast_4 62.5%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 4.1 127.3sec
munched_ignite 3.3 88.7sec
rolled_ignite 5.2 64.1sec

Statistics & Data Analysis

DPS
Population
Convergence 71.34%
σ of the average dps 8.0233
2 * σ / μ 0.0559%
95% Confidence Intervall ( μ ± 2σ ) ( 28697.11 - 28729.20 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28689.09 - 28737.23 )
Sample Data
σ 802.3349
Minimum 25995.91
Maximum 31835.90
Spread ( max - min ) 5839.99
Range ( max - min ) / 2 2920.00
Range% 10.17
10th Percentile 27762.12
90th Percentile 29807.06
( 90th Percentile - 10th Percentile ) 2044.94
Approx. Iterations needed for
1% dps error 31
0.1% dps error 3123
0.1 scale factor error with delta=300 5722
0.05 scale factor error with delta=300 22888
0.01 scale factor error with delta=300 572214
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 focus_magic
3 arcane_brilliance
4 mage_armor
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
A volcanic_potion,if=!in_combat
B volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
C arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
D mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
E mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
F flame_orb,if=target.time_to_die>=10
G presence_of_mind,arcane_blast
H arcane_blast,if=target.time_to_die<60&mana_pct>4
I arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
J evocation,invulnerable=1
K evocation,if=target.time_to_die>=31
L sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
M arcane_missiles
N arcane_barrage,if=buff.arcane_blast.stack>0
O arcane_barrage,moving=1
P fire_blast,moving=1
Q ice_lance,moving=1
R restart_sequence,name=conserve

Sample Sequence

0124A9CDEGFIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKLLLLLNMRLLLL9FLNMRLLLLLMRLLLLLNMRLLLGLLMRLLLLLNMRLLLLLMIIFII9BCDIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKMERLFGLL9LLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLFLLLLMIIII9CD7IIIIIIIIIIGIIIIIIIIIIIIIIIIIIIKFMRLLL9LLMRLLLLLNRLLLLLNMRLLLLLNRLLLLLNMRLGLLLLFMRLLLLLMRLIII9CEIDIIIIIIIIIIIIIIIIIIIIIIIIIIIIIFKLLLLM9RLLLGLLMRLLLLLMRLLLLLMRLLLLLHHHFHHHHHHHHHHCHHH9HDHHHHHHHHHHHHHHHHHHHHHHHHH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 631 52 20
Agility 648 68 20
Stamina 7658 6035 5972
Intellect 6116 5416 4957
Spirit 291 291 101
Health 143995 121343 0
Mana 113691 103280 0
Spell Power 9145 7613 2207
Spell Hit 15.63% 15.63% 1601
Spell Crit 24.20% 15.12% 514
Spell Haste 20.14% 14.42% 1420
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 673 32 0
Melee Hit 13.33% 13.33% 1601
Melee Crit 14.56% 6.66% 514
Melee Haste 11.09% 11.09% 1420
Expertise 0.00 0.00 0
Armor 12578 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.05% 17.05% 1622

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 3
Invocation 2
Improved Arcane Missiles 2
Improved Blink 0
Arcane Flows 2
Presence of Mind 1
Missile Barrage 2
Prismatic Cloak 3
Improved Polymorph 0
Arcane Tactics 1
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 2
Slow 1
Nether Vortex 2
Focus Magic 1
Improved Mana Gem 2
Arcane Power 1
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 2
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Arcane_T11_372
origin="http://chardev.org/?profile=35357"
level=85
race=gnome
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
glyphs=evocation/arcane_power/slow/mirror_image/arcane_brilliance/conjuring/arcane_blast/arcane_missiles/mage_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/focus_magic
actions+=/arcane_brilliance
actions+=/mage_armor
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
actions+=/arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
actions+=/flame_orb,if=target.time_to_die>=10
actions+=/presence_of_mind,arcane_blast
actions+=/arcane_blast,if=target.time_to_die<60&mana_pct>4
actions+=/arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
actions+=/evocation,invulnerable=1
actions+=/evocation,if=target.time_to_die>=31
actions+=/sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
actions+=/arcane_missiles
actions+=/arcane_barrage,if=buff.arcane_blast.stack>0
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1
actions+=/restart_sequence,name=conserve
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist=soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5972
# gear_intellect=4957
# gear_spirit=101
# gear_spell_power=2207
# gear_hit_rating=1601
# gear_crit_rating=514
# gear_haste_rating=1420
# gear_mastery_rating=1622
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# trinket2=shard_of_woe,heroic=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_Frostfire_T11_372 : 24891dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24891.2 19.91 / 0.08% 27.0 921.2 791.4 mana 0.00% 39.0
Origin http://chardev.org/?profile=88851
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • frostfire
  • pyroblast
  • molten_armor

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56203|43974|39905|14268|9008|947&chds=0,112405&chco=C41F3B,C41F3B,C41F3B,2459FF,C41F3B,2459FF&chm=t++56203++flame_orb,C41F3B,0,0,15|t++43974++living_bomb,C41F3B,1,0,15|t++39905++pyroblast_hs,C41F3B,2,0,15|t++14268++frostfire_bolt,2459FF,3,0,15|t++9008++scorch,C41F3B,4,0,15|t++947++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:47,15,14,9,7,4,2,1,0,0,0,0&chds=0,100&chco=2459FF,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=frostfire_bolt|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t8777766555543333222211110zzzyyyyxxxxwwvvuuuuuuutttttsrrrrrrrrrqqqpppooooonnnnmmllllllkkkkjjjiiiiiiihhhhggggffffffeeedddehjiiiiihhgggggfffffeeeddddddcccccbbbaaaaaaaZZZYYYYXXXXXXWWWVVUUUTTTTTSSRRRRQQQQQPPPPOOOONNNNNNMMMLLLLKKKKKKJJJIIIIIHHHHHJLMMMLLLLLKKKKJJJJIIIIIHHHHGGGGGFFFFFFFEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEFFFFFFGGGGGHHHHHHIIIIIIIIJJJJJJJJJJJJJJJJJJJJJKKKKKKLLLLLLMMMMMMNNNNNNNNNOOOOOOOOOOPPPPPPPPQQQQQQRRRRSSSSSSSTTTTTTTTTTUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116462&chtt=Mage_Fire_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:knqrttvwxxy12567764531zxxvusqpnlkjhhffeeddddcbbbaaaaabbbbbbaaaaaaabbbbaaZZYYYYYYYYYXXWWWWWWWXYYYYYYYYYZZZaaaaaZZZZZZZZZZZZYYZZZZaabccccccdddeeffffffeeedddddddddccbbaaaaaaaZZZYYYYZZabccdddeeffgggghgggfeedccbbaaZYYXXXXXXXXXXXXXXXXXYYYZZZZZZZZZZaabbbbbccccccccccddddccccccccccccccccccdddddddccccbbbbbbbaaZZZZZZZZZZZaaaaaaaabbbbcccccccccccccbbbbbbbaaaaaaZZZZZZZZaaabbccdeffghijjkkkkkkkkkjjjiihggffeddddcccccbbbbbbbbbbbbccccdddddeeeeeffffffffffeeedddddddddc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24891|max=50906&chxp=1,1,49,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,4,6,3,18,24,27,49,48,69,117,156,190,223,301,351,389,453,482,536,580,570,570,602,568,506,502,465,414,360,305,237,178,149,127,109,81,67,48,29,27,11,12,9,9,4,3,5,2,3&chds=0,602&chbh=5&chxt=x&chxl=0:|min=21601|avg=24891|max=28893&chxp=0,1,45,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_Frostfire_T11_372 24891
combustion 1652 6.6% 3.8 129.72sec 196124 171093 8185 16931 22952 31.2% 0.1% 0.0% 0.0% 53 9987 20792 31.5% 0.0% 8.5%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.81 3.81 52.68 52.68 1.1463 0.7277 747074
Direct Results Count Pct Average Min Max Total Damage
hit 2.6 68.68% 8184.63 7082 11170 21412
crit 1.2 31.21% 16931.42 14552 22952 20126
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 36.1 68.48% 9987.30 3394 27840 360292
crit 16.6 31.52% 20792.47 6974 57207 345244

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:10117.04
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 70 0.3% 10.2 46.25sec 3081 0 2618 4048 4434 32.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.21 10.21 0.00 0.00 0.0000 0.0000 31470
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 67.27% 2618.00 2562 2870 17990
crit 3.3 32.60% 4048.13 3959 4434 13480
miss 0.0 0.13% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
flame_orb 1073 4.3% 7.7 61.14sec 63227 56203 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.79 0.00 1.1250 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.85% 0.00 0 0 0
miss 0.0 0.15% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.19sec 7199 0 5464 11231 14777 30.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55154
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.66% 5464.11 4925 7191 29160
crit 2.3 30.21% 11230.83 10121 14777 25994
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 951 3.8% 114.8 3.70sec 3745 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2820 5835 30.8% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.79 0.00 0.00 114.79 0.0000 0.0000 429936
Tick Results Count Pct Average Min Max Total Damage
hit 79.3 69.09% 2820.10 2437 3893 223649
crit 35.4 30.80% 5835.20 5008 7999 206287
miss 0.1 0.12% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
frostfire_bolt 11588 46.6% 209.2 2.15sec 25053 14268 18535 38239 54480 30.5% 0.1% 0.0% 0.0% 194 490 1010 30.5% 0.0% 98.6%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
209.18 208.53 193.94 193.94 1.7559 2.2983 5240714
Direct Results Count Pct Average Min Max Total Damage
hit 144.6 69.34% 18534.64 16101 26513 2679920
crit 63.7 30.54% 38238.84 33086 54480 2435095
miss 0.3 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 134.8 69.51% 489.66 254 698 66015
crit 59.1 30.49% 1009.50 548 1435 59684

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:405.75
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
ignite 3744 15.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 214 7901 0 0.0% 0.0% 94.8%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 188.86 214.29 214.29 0.0000 2.0000 1693145
Direct Results Count Pct Average Min Max Total Damage
hit 188.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 214.3 100.00% 7901.36 148 58659 1693145

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1839.91
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4073 16.4% 35.9 12.80sec 51361 43974 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6550 13527 30.6% 0.0% 93.4%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.86 35.86 186.34 186.34 1.1680 2.2664 1618929
Direct Results Count Pct Average Min Max Total Damage
hit 35.8 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.2 69.35% 6549.81 5492 10800 846456
crit 57.1 30.65% 13526.53 11286 22191 772473

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 493 2.0% 35.8 12.64sec 6229 0 4724 9747 13716 30.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.82 35.82 0.00 0.00 0.0000 0.0000 223135
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 69.80% 4724.09 4154 6675 118113
crit 10.8 30.08% 9747.38 8536 13716 105022
miss 0.0 0.13% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2238 9.0% 21.7 20.18sec 46573 39905 21912 45131 64225 40.5% 0.1% 0.0% 0.0% 99 2358 4864 40.6% 0.0% 50.0%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.73 21.65 99.11 99.11 1.1671 2.2822 1012010
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 59.34% 21912.46 19113 31256 281441
crit 8.8 40.53% 45130.70 39274 64225 395963
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 58.9 59.38% 2357.98 1985 3898 138785
crit 40.3 40.62% 4864.40 4079 8010 195820

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.2 4.70sec 11047 9008 8705 17961 23247 25.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.15 0.15 0.00 0.00 1.2264 0.0000 1664
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 74.57% 8705.29 7718 11313 978
crit 0.0 25.37% 17961.07 15859 23247 686
miss 0.0 0.07% 0.00 0 0 0

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 572
mirror_fire_blast 117 20.5% 34.3 33.51sec 1219 0 1172 1757 2116 10.0% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.28 34.28 0.00 0.00 0.0000 0.0000 41776
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.01% 1172.40 1105 1410 35769
crit 3.4 9.97% 1757.41 1658 2116 6007
miss 0.3 1.02% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 455 79.5% 85.7 12.82sec 1893 947 2024 3035 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.69 77.12 0.00 0.00 2.0000 0.0000 162228
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.10% 2024.12 1912 2421 139086
crit 7.6 9.89% 3035.41 2868 3631 23142
miss 0.8 1.01% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_Frostfire_T11_372
flame_orb mana 1.8% 65.9 960
frostfire_bolt mana 73.9% 17.0 1472
living_bomb mana 23.3% 18.9 2711
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29492.8 16.3 0.0%
clearcasting none 25.1 39543.5 1574.5 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 621.9 112950.5 181.6 0.0%
mana_gem mana 3.0 36311.2 12103.7 0.0%
master_of_elements mana 109.8 40152.5 365.6 0.0%
mp5_regen mana 1809.6 78697.2 43.5 0.0%
replenishment mana 1809.6 54440.3 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 210.2 0.0 2.1sec 2.1sec 80% 80%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.2 0.0 46.2sec 46.2sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 21.8 1.0 20.2sec 19.2sec 9% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.1 0.0 52.0sec 52.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 34% 34%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 510.6sec 510.6sec 66% 66%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.3sec 47.3sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.2sec 115.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.6sec 414.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.8 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.9sec
munched_ignite 121.1 3.7sec
rolled_ignite 20.3 21.6sec

Statistics & Data Analysis

DPS
Population
Convergence 71.67%
σ of the average dps 9.9528
2 * σ / μ 0.0800%
95% Confidence Intervall ( μ ± 2σ ) ( 24871.32 - 24911.13 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24861.37 - 24921.08 )
Sample Data
σ 995.2843
Minimum 21600.78
Maximum 28892.93
Spread ( max - min ) 7292.15
Range ( max - min ) / 2 3646.08
Range% 14.65
10th Percentile 23673.45
90th Percentile 26190.36
( 90th Percentile - 10th Percentile ) 2516.92
Approx. Iterations needed for
1% dps error 63
0.1% dps error 6395
0.1 scale factor error with delta=300 8805
0.05 scale factor error with delta=300 35221
0.01 scale factor error with delta=300 880525
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I frostfire_bolt
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIIIIIIFIIIIIGIDIFIIIIIIIIIFIIIIIIIFIIIIGHIFIIIGIIIFIIIIIIFIIIIIIFIIIIIGIFIIBIHIIIFIIIIIIFIIIIIIFGIDIIIIFIIGIIIIAFEGIHIIIIFGIIIIIIFIIIIIGIFIIIIIIFGIIIIIBIFGHIIIGIFIIIIIGIFIIIIIDGFIIIIIIIJIIFGIIHIIIFIIIIIIFIIIIIIFIIIIGIIFGIIIIAIEFIIHGIIIIFIIIIIIFIIIIIIFIIIIIIFIIIIIGIFDHIIIIIFIIIIIIFGIIIIIIFIIIIIIFIIIGIIIFHIIIIIIFGII9IGIIFIIIIIIFIIIIIIFAIIII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_Frostfire_T11_372
origin="http://chardev.org/?profile=88851"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/frostfire/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/frostfire_bolt
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_T11_372 : 26104dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26103.5 20.04 / 0.08% 28.6 911.3 779.4 mana 0.00% 39.2
Origin http://chardev.org/?profile=88793
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • fireball
  • pyroblast
  • molten_armor

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56267|44040|39485|14476|9293|949&chds=0,112534&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF&chm=t++56267++flame_orb,C41F3B,0,0,15|t++44040++living_bomb,C41F3B,1,0,15|t++39485++pyroblast_hs,C41F3B,2,0,15|t++14476++fireball,C41F3B,3,0,15|t++9293++scorch,C41F3B,4,0,15|t++949++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:44,17,14,10,7,4,2,1,0,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=fireball|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77777666555433333222211110zzzyyyyxxxxxwvvvvvuuuuuuttssssssssrrrrqqppppppoooonnmmmmmmmlllllkkjjjjjjjiiiihhhhhggggggfffeefjkkjjjjjiihhhhhhhggggfffeeeeeeeedddccccccbbbbbaaaZZZZZZZYYYXXWWWVVVVUUUUTTTSSSSSSRRRQQQQPPPPPPPOOONNNNNMMMMMLLLLKKKKKKJJLOPOOOONNNNNNMMMLLLLKKKKKKJJJJIIIIIHHHHHGGGGGFFFFFFFFEEEEEEDDDDDDDDDCCCCCCCDDDDCDDDDDDDDDEEEEEEEFFFFFGGGGGGGHHHHHHHIIIIIIIIIIIIIIIIIIIJJJJJJKKKKKLLLLLLMMMMMMMMNNNNNNNNOOOOOOOOPPPPPPPQQQQQRRRRRSSSSSSSSTTTTTTTTTUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116457&chtt=Mage_Fire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:jmnprstvwxy024677865310yxvusqonljihgeeddccccbbaaZaZZZabbaaaaaaaZaaabbaaZZYYXXYXYYYXXWWWWVVVWWXXXXXXXXYYYZZZZZZZZZYYYYYYYZYYYYZZZaabccccccdddeeefffffeeddddddddccbbaaaZZZZZZZYYYYYYYYZaabbccdddeeefffffeeedcbbbaaZZYYXXWWWWWXXXXXXXXXXXXXYYYYZZZZZZZaaabbbccccccccddddddddddccccccccccccccccccddcccccbbbbbbbaaZZZYYYYYYZZZZZZZZZZZZaaaaaaaaaaaaaabbbbaaaaaaaaaaZZZZZZZZZaaabbccddefgghiijjjkkjjjjjjjiihhgffeeedddccccbbbbbbbbbbbbbbbbbbcccccddddeeeeeeeeeddddddddddcc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26104|max=54352&chxp=1,1,48,100&chtt=Mage_Fire_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,0,2,6,8,25,27,51,52,89,108,162,156,216,275,330,372,407,471,493,505,603,553,578,573,523,472,434,422,347,312,294,236,201,139,128,126,81,53,47,43,22,18,7,10,7,5,9&chds=0,603&chbh=5&chxt=x&chxl=0:|min=22561|avg=26104|max=29629&chxp=0,1,50,100&chtt=Mage_Fire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_T11_372 26104
combustion 1793 6.9% 3.9 127.00sec 207089 180636 8217 17059 22952 31.8% 0.1% 0.0% 0.0% 54 10542 21946 31.7% 0.0% 8.7%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.92 3.92 54.25 54.25 1.1464 0.7252 810856
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 68.11% 8216.60 7082 11170 21914
crit 1.2 31.77% 17059.22 14552 22952 21222
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 37.1 68.34% 10541.81 3628 25916 390776
crit 17.2 31.66% 21946.10 7455 53253 376944

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:10204.71
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.1 46.57sec 3081 0 2617 4047 4434 32.7% 0.2% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.15 10.15 0.00 0.00 0.0000 0.0000 31265
Direct Results Count Pct Average Min Max Total Damage
hit 6.8 67.14% 2617.27 2562 2870 17832
crit 3.3 32.70% 4047.15 3959 4434 13432
miss 0.0 0.16% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
fireball 11598 44.4% 206.3 2.18sec 25420 14476 18526 38198 54499 35.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
206.32 205.57 0.00 0.00 1.7560 0.0000 5244632
Direct Results Count Pct Average Min Max Total Damage
hit 132.1 64.25% 18525.96 16106 26522 2446870
crit 73.2 35.63% 38198.03 33096 54499 2797761
miss 0.2 0.12% 0.00 0 0 0

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.124000
  • base_dd_min:898.89
  • base_dd_max:1146.36
flame_orb 1074 4.1% 7.7 61.17sec 63339 56267 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.73 0.00 1.1257 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 123 0.5% 7.7 61.23sec 7237 0 5473 11246 14777 30.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55410
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.19% 5472.57 4925 7191 28991
crit 2.3 30.68% 11245.85 10121 14777 26419
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 951 3.6% 114.7 3.71sec 3750 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2819 5829 31.0% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.73 0.00 0.00 114.73 0.0000 0.0000 430195
Tick Results Count Pct Average Min Max Total Damage
hit 79.0 68.86% 2818.86 2437 3893 222719
crit 35.6 31.02% 5829.45 5008 7999 207476
miss 0.1 0.11% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 4392 16.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 208 9544 0 0.0% 0.0% 92.0%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 178.48 208.06 208.06 0.0000 2.0000 1985829
Direct Results Count Pct Average Min Max Total Damage
hit 178.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 208.1 100.00% 9544.40 745 55464 1985829

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:11658.71
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4068 15.6% 35.8 12.83sec 51430 44040 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6548 13523 30.8% 0.0% 93.2%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.77 35.77 185.91 185.91 1.1678 2.2657 1617005
Direct Results Count Pct Average Min Max Total Damage
hit 35.7 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.6 69.19% 6548.46 5492 10800 842294
crit 57.3 30.81% 13522.78 11286 22191 774711

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 492 1.9% 35.7 12.68sec 6230 0 4716 9729 13716 30.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.73 35.73 0.00 0.00 0.0000 0.0000 222596
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 69.56% 4716.21 4154 6675 117211
crit 10.8 30.32% 9728.65 8536 13716 105386
miss 0.0 0.12% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2653 10.2% 26.0 17.02sec 46075 39485 21898 45108 64225 40.6% 0.1% 0.0% 0.0% 115 2355 4857 40.7% 0.0% 58.1%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.04 25.94 115.02 115.02 1.1669 2.2830 1199818
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 59.30% 21897.73 19113 31256 336829
crit 10.5 40.58% 45107.62 39274 64225 474848
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 68.2 59.26% 2355.35 1985 3898 160559
crit 46.9 40.74% 4856.97 4079 8010 227582

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.2 4.56sec 11375 9293 8752 18250 24679 27.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.16 0.16 0.00 0.00 1.2240 0.0000 1817
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 72.39% 8752.44 7718 12010 1012
crit 0.0 27.61% 18249.50 15859 24679 805

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 573
mirror_fire_blast 117 20.5% 34.3 33.51sec 1221 0 1175 1762 2116 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.28 34.28 0.00 0.00 0.0000 0.0000 41850
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 89.15% 1174.72 1105 1410 35896
crit 3.4 9.86% 1762.08 1658 2116 5954
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 456 79.5% 85.7 12.82sec 1897 949 2028 3042 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.69 77.13 0.00 0.00 2.0000 0.0000 162575
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.13% 2028.06 1912 2421 139414
crit 7.6 9.87% 3042.33 2868 3631 23161
miss 0.8 1.00% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_T11_372
fireball mana 73.6% 17.3 1470
flame_orb mana 1.8% 66.1 958
living_bomb mana 23.6% 18.9 2716
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29488.5 16.3 0.0%
clearcasting none 25.1 39452.6 1572.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 565.9 102982.7 182.0 0.0%
mana_gem mana 3.0 36308.0 12102.7 0.0%
master_of_elements mana 119.8 44743.4 373.6 0.0%
mp5_regen mana 1809.6 78686.2 43.5 0.0%
replenishment mana 1809.6 54390.1 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 207.3 0.0 2.2sec 2.2sec 79% 79%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 26.2 1.4 16.9sec 16.0sec 11% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.1 0.0 52.4sec 52.4sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 31% 31%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 519.0sec 519.0sec 69% 70%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 48.1sec 48.1sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.0sec 115.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.8 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.9sec
munched_ignite 93.6 4.8sec
rolled_ignite 16.6 26.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.45%
σ of the average dps 10.0200
2 * σ / μ 0.0768%
95% Confidence Intervall ( μ ± 2σ ) ( 26083.46 - 26123.54 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26073.44 - 26133.56 )
Sample Data
σ 1001.9951
Minimum 22560.75
Maximum 29629.42
Spread ( max - min ) 7068.67
Range ( max - min ) / 2 3534.34
Range% 13.54
10th Percentile 24875.21
90th Percentile 27439.70
( 90th Percentile - 10th Percentile ) 2564.49
Approx. Iterations needed for
1% dps error 58
0.1% dps error 5893
0.1 scale factor error with delta=300 8924
0.05 scale factor error with delta=300 35697
0.01 scale factor error with delta=300 892439
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I fireball
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIIIIGIFDIIIGIIIIFIIIGIIIIIFIIIIIIIFIIIIIHIFGIIIIIIFIIIIIIFIIIIGIIFGIIIGIIFIIBIHIIIFIIIIIIFIIIIIGIFDIIIIIIFIIIIIIAFEIHIIIGIFIIIIIIFIIIIIIFGIIGIIIFIIIIIIBFIHGIIIIFIIIIGIIFGIIGIDGIFIIIGIIIFGIIIIIHFJIIIIIIFIIIIIIFIIGIIIGFIIIIIIFIIAEIIHGIFIIIIGIIFIIIIIIFIIIIGIDFIIIIGIIFIIIGHIIFIIIGIIIFIIIIIIFIIGIIIIFIIIIIGIFIIHIIIIFIIIII9IFGIIIIIIFIIIGIDIFII4AIII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_T11_372
origin="http://chardev.org/?profile=88793"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/fireball/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/fireball
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_Frostfire_T11_372 : 25112dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25111.5 11.52 / 0.05% 27.9 901.4 761.0 mana 0.01% 42.9
Origin http://chardev.org/?profile=87205
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • ice_lance
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:78623|34935|31086|19941|13727|2434|989&chds=0,157245&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++78623++deep_freeze,2459FF,0,0,15|t++34935++frostfire_orb,2459FF,1,0,15|t++31086++ice_lance,2459FF,2,0,15|t++19941++frostbolt,2459FF,3,0,15|t++13727++frostfire_bolt,2459FF,4,0,15|t++2434++water_bolt,2459FF,5,0,15|t++989++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:37,23,13,10,7,5,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostfire_bolt|ice_lance|deep_freeze|water_bolt|ignite|frostbolt|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77766665555544444332111100000zzzyyyxxxwwwvvvuuuutttssssrrrrrqqqqppppooonnnnnmmmmmllllkkkkkkjjjjjjiiiihhhhhggggggggffffegjkkkjjjjjiiiiihhhhhhggggggggffffeeeeeeddddddccccbbbbbbaaaaaaZZYYYYYXXXXXXXWWWWWWVVVVVVUUUUUTTTSSSSRRRRQQQQQPPPPOOONNNNNNPRSSSSRRRRRRQQQQQQQPPPPPPPOOOOOONNNNNNNNMMMMMMLLLLLLLLLLLKKKKKKKKKKKKKKKJJJJJJJJJJJKKKKKKKKKLLLLLLMMMMMMNNNNNNNNNNOOOOOOOOOOOOOOOOOPPPPPPQQQQRRRRSSSSSTTTTTUUUUUUUVVVVVVVWWWWWWWWWXXXXXXXXYYYYYYZZZZZZZaaaaaaaaaaaa&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118829&chtt=Mage_Frost_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:34466777654768033210ywuxxvtrqqponnmnlllklmoplklllmmmmortuvvvvvvuttuuvvxxxyvtrqppponmmkklllkjjjjjjjkklklkkkkkjihhggffeeeeffgghijkklllllmlmmmlkkjjjihgggghhhiijjjjjjiiiihhhgfeeddccbccdfgijklmopqqssssssrrqpnmlkjjiiihihiijjjkkllllllllllkkkkkjkjjjkklmmnnonnonnmmlllllkkjjihggffffffgghhhihihihiiijjjjjihgffeeeeeeffgghghhiiijjkkkkkkkkjjiihhggggggggggghhhhhhhhhihhhggggggghhijkmnoprrttuuuuuuttsrqonlkihgeedddddddeeeffffggghhhhhgggggghhiijjkllmmnnnnnnopppppppooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25112|max=40142&chxp=1,1,63,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,2,2,8,13,17,20,33,52,68,108,146,183,241,290,343,372,463,537,588,594,660,648,605,599,559,462,484,360,352,244,248,174,133,94,93,59,45,25,21,20,13,7,5,1,3,2,1,2&chds=0,660&chbh=5&chxt=x&chxl=0:|min=23005|avg=25112|max=27510&chxp=0,1,47,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_Frostfire_T11_372 25112
cold_snap 0 0.0% 1.5 386.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.49 1.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 69 0.3% 10.1 46.80sec 3078 0 2609 4037 4434 33.8% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 31110
Direct Results Count Pct Average Min Max Total Damage
hit 6.6 65.70% 2609.47 2562 2870 17329
crit 3.4 33.78% 4036.54 3959 4434 13780
miss 0.1 0.52% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3289 13.1% 16.1 28.78sec 92518 78623 42680 94303 151697 97.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.08 16.08 0.00 0.00 1.1767 0.0000 1487256
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 2.54% 42680.43 39611 63277 17452
crit 15.6 96.96% 94303.41 81395 151697 1469804
miss 0.1 0.50% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 1226 4.9% 27.6 16.51sec 20061 19941 15069 31218 41335 31.8% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.63 27.54 0.00 0.00 1.0060 0.0000 554286
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 67.66% 15068.95 13668 20116 280848
crit 8.8 31.80% 31217.96 28086 41335 273438
miss 0.1 0.54% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.857000
  • base_dd_min:662.43
  • base_dd_max:844.80
frostfire_bolt 9286 37.0% 175.9 2.54sec 23875 13727 17157 35993 70339 33.0% 0.5% 0.0% 0.0% 192 459 948 32.6% 0.0% 97.8%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
175.87 175.30 191.90 191.90 1.7393 2.3046 4198804
Direct Results Count Pct Average Min Max Total Damage
hit 116.6 66.51% 17157.20 15631 27796 2000525
crit 57.8 32.96% 35993.13 32119 70339 2079510
miss 0.9 0.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.3 67.36% 459.20 184 784 59360
crit 62.6 32.64% 948.48 377 1612 59409

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:372.99
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 835 3.3% 9.0 51.53sec 41988 34935 0 0 0 0.0% 0.5% 0.0% 0.0% 123 0 0 0.0% 0.0% 27.1%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.99 8.99 122.55 0.00 1.2019 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.48% 0.00 0 0 0
miss 0.0 0.52% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing ${$84721m1} Frost damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 835 3.3% 122.6 3.50sec 3079 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2295 4769 32.2% 0.5% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.55 0.00 0.00 122.55 0.0000 0.0000 377365
Tick Results Count Pct Average Min Max Total Damage
hit 82.4 67.27% 2294.89 2057 2934 189187
crit 39.5 32.20% 4769.12 4228 6029 188178
miss 0.7 0.54% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 5756 22.9% 71.8 6.30sec 36240 31086 0 36505 57773 99.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
71.83 71.68 0.00 0.00 1.1658 0.0000 2602923
Direct Results Count Pct Average Min Max Total Damage
crit 71.3 99.47% 36504.74 31440 57773 2602923
miss 0.4 0.53% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1724 6.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 186 4196 0 0.0% 0.0% 82.2%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 131.76 185.76 185.76 0.0000 2.0000 779545
Direct Results Count Pct Average Min Max Total Damage
hit 131.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 185.8 100.00% 4196.48 56 24031 779545

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:182.88
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 596
mirror_fire_blast 122 20.5% 34.2 33.50sec 1273 0 1226 1838 2437 9.8% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.20 34.20 0.00 0.00 0.0000 0.0000 43545
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.18% 1226.15 1105 1625 37402
crit 3.3 9.77% 1837.77 1657 2437 6143
miss 0.4 1.04% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 474 79.5% 85.5 12.82sec 1977 989 2114 3167 4167 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.51 76.96 0.00 0.00 2.0000 0.0000 169066
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.14% 2113.86 1912 2778 145014
crit 7.6 9.87% 3167.24 2867 4167 24053
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2460
freeze 27 1.1% 17.0 27.42sec 714 0 540 1078 1155 33.2% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12128
Direct Results Count Pct Average Min Max Total Damage
hit 11.2 65.81% 539.82 529 569 6038
crit 5.6 33.22% 1078.47 1055 1155 6090
miss 0.2 0.97% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2433 98.9% 205.7 2.19sec 5343 2434 4045 8134 10724 33.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.68 204.57 0.00 0.00 2.1949 0.0000 1099056
Direct Results Count Pct Average Min Max Total Damage
hit 134.1 65.56% 4045.24 3682 5376 542490
crit 68.4 33.45% 8134.37 7346 10724 556566
miss 2.0 1.00% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_Frostfire_T11_372
deep_freeze mana 6.2% 59.0 1567
frostbolt mana 13.8% 9.8 2037
frostfire_bolt mana 59.4% 17.3 1377
frostfire_orb mana 2.1% 44.7 940
ice_lance mana 16.6% 38.6 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29459.4 16.3 0.1%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 462.4 82231.2 177.8 0.0%
mana_gem mana 3.0 36300.7 12100.2 0.0%
master_of_elements mana 153.8 57363.3 373.1 0.0%
mp5_regen mana 1809.6 78609.4 43.4 0.1%
replenishment mana 1809.6 54306.6 30.0 0.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.5sec 187.5sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 4.2 0.0 82.5sec 82.5sec 0% 2%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 200.1 0.0 2.2sec 2.2sec 70% 70%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.8sec 46.8sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 33.6 48.2 13.6sec 5.5sec 77% 98%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.0sec 104.0sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 245.4sec 245.4sec 26% 26%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.3 0.0 425.8sec 425.8sec 74% 75%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.7sec 48.7sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 114.2sec 114.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 65.2sec 65.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.8sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.7 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 27.7 16.5sec
mana_gem 3.0 120.8sec
munched_ignite 32.2 13.5sec
rolled_ignite 10.5 38.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.59%
σ of the average dps 5.7597
2 * σ / μ 0.0459%
95% Confidence Intervall ( μ ± 2σ ) ( 25100.01 - 25123.05 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25094.25 - 25128.81 )
Sample Data
σ 575.9680
Minimum 23004.91
Maximum 27509.82
Spread ( max - min ) 4504.92
Range ( max - min ) / 2 2252.46
Range% 8.97
10th Percentile 24389.64
90th Percentile 25866.73
( 90th Percentile - 10th Percentile ) 1477.09
Approx. Iterations needed for
1% dps error 21
0.1% dps error 2104
0.1 scale factor error with delta=300 2948
0.05 scale factor error with delta=300 11795
0.01 scale factor error with delta=300 294879
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*15)<target.time_to_die
M frostbolt,if=!cooldown.early_frost.remains
N frostfire_bolt
O ice_lance,moving=1
P fire_blast,moving=1

Sample Sequence

01359BJDEHMNJNNNJNJNJNMNNNNNJNJNNHMNNNNFGNNJNNNNMJJKJNNNAJDJHCDGMHNNJNJNNKNKJMNNJNNJNNHMNNNKNJNNNMNJNBNNDNHJJKMJKNKKNJNNNJMNNNNNHNNNMJNNJNNNNEMJDNNHKNKJJJJMNNNJNGNNJNNMNNNHNNNNNFJMNNNNNBNNNDNJMNHNJNNNNJMJINNKNJNNMNHNNNNNNMNNLJJNDNNMNHJNNNJNKMNJNNNNNNMNNHNNNGNJNMNEJNNNDNNNJJMJHKKNJNJNNMNJNJNNJNKMNFHNNJNNNNNMNNDNNJKJNJHMNNCDGHNNNNNMNNJKJNNNNNMNJNHNN4NKMNJNNNNNNMNNDNHNKNKJJMNNNNNNNNMNNHK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.47% 16.47% 1687
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.05% 14.05% 1687
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.43% 7.43% 973

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_Frostfire_T11_372
origin="http://chardev.org/?profile=87205"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/ice_lance/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*15) actions+=/frostbolt,if=!cooldown.early_frost.remains
actions+=/frostfire_bolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1687
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=973
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_T11_372 : 26039dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26039.1 10.55 / 0.04% 20.8 1253.8 1097.2 mana 0.02% 48.7
Origin http://chardev.org/?profile=87885
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • frostbolt
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:77835|39044|35390|29605|15189|2414|990&chds=0,155669&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++77835++deep_freeze,2459FF,0,0,15|t++39044++frostfire_bolt,2459FF,1,0,15|t++35390++frostfire_orb,2459FF,2,0,15|t++29605++ice_lance,2459FF,3,0,15|t++15189++frostbolt,2459FF,4,0,15|t++2414++water_bolt,2459FF,5,0,15|t++990++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:40,18,12,11,9,4,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostbolt|ice_lance|deep_freeze|frostfire_bolt|water_bolt|ignite|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t87766555444332221100zzyyxxwwwwvvuttssrrqqpoonnmmllkkjjjjiihhggggffeeeddcccbbbaaaZZZYYYXXWWWVVVUUUUTTTSSSSSSSSSSSSRRRRRRSWXXWWWWWWWWWVVVVVVVVVVVVVVVVVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVVVWWWWWWWWXXXXXXXXXXXXXXXXXXXXWWWWWWWWWWWVVVVVVVVUUUUUXaaaaaaaaabbbbbbaaaaaaaaaaaaaZZZZZZZZZZZZYYYYYYYYYYYXXXXXXXXXXWWWWWWWWWWVVVVVVVVVUUUUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTSSSSSSRRRRRQQQQQQPPPPPPPPPPPPPPPPPPPPPPPPPPPOOOOOOOOOOOONNNNNNNMMMMMMMMMMLMMMMMMMMMMMMMMMMMMMMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118833&chtt=Mage_Frost_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13355676654768133220yxvxwusrppoommmnlmlllmoolklllmmmmoqrrssttttssstuuuvvvwussrqpponmmllkkkjiiiiiiijjjjjjjjjjihhhggffeeedeeefgghiijjkjkkkkklkkkjjiihhgggggghhhhihhhhhggggfffeedcbbbbbcdefgijklmnoppppqqppoonmlkjjihhgggghhiijjjjjkkkkkkkkkkkkkkkkjjkklklllllmllkkkkjjjjjiihhggfffefefffffgggggghhhhhihihhgggffffeeffffffggghhiijjjjjkjkjjiiiihhhhhgggggggghghhhhhhhhgggggghhhiijkllnnopqqrrssrsrrqppnnlkjihgfeeeededddeeefffffggggggggggghhiijjjkklllllllmmnnnnnnnmmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26039|max=42531&chxp=1,1,61,100&chtt=Mage_Frost_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,4,3,5,9,11,24,36,58,87,98,147,172,236,264,368,354,412,505,514,540,605,597,619,614,510,482,464,419,370,300,248,231,176,143,108,71,55,40,33,19,15,7,10,7,4,1,1,1&chds=0,619&chbh=5&chxt=x&chxl=0:|min=24163|avg=26039|max=28105&chxp=0,1,48,100&chtt=Mage_Frost_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_T11_372 26039
cold_snap 0 0.0% 1.5 388.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.46 1.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 69 0.3% 10.1 47.00sec 3080 0 2610 4039 4434 33.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.06 10.06 0.00 0.00 0.0000 0.0000 30995
Direct Results Count Pct Average Min Max Total Damage
hit 6.7 66.97% 2610.01 2562 2870 17591
crit 3.3 32.98% 4038.76 3959 4434 13403
miss 0.0 0.05% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3215 12.3% 15.9 29.14sec 91473 77835 43106 94109 151188 94.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.89 15.89 0.00 0.00 1.1752 0.0000 1453888
Direct Results Count Pct Average Min Max Total Damage
hit 0.8 5.08% 43105.90 39444 63065 34825
crit 15.1 94.87% 94109.19 81052 151188 1419063
miss 0.0 0.05% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 10542 40.5% 230.5 1.95sec 20677 15189 14995 31076 41335 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
230.54 229.79 0.00 0.00 1.3613 0.0000 4766827
Direct Results Count Pct Average Min Max Total Damage
hit 147.4 64.16% 14995.06 13668 20116 2210745
crit 82.3 35.79% 31076.45 28086 41335 2556082
miss 0.1 0.04% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.857000
  • base_dd_min:662.43
  • base_dd_max:844.80
frostfire_bolt 2745 10.5% 27.3 16.13sec 45455 39044 20132 44077 70103 94.6% 0.0% 0.0% 0.0% 122 361 742 71.5% 0.0% 61.4%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.31 27.22 121.65 121.65 1.1642 2.2831 1241156
Direct Results Count Pct Average Min Max Total Damage
hit 1.5 5.39% 20132.12 18456 29333 29538
crit 25.7 94.56% 44077.32 37924 70103 1134599
miss 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 34.7 28.53% 361.00 205 869 12531
crit 86.9 71.47% 741.75 421 1786 64488

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:276.84
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 842 3.2% 9.0 51.75sec 42525 35390 0 0 0 0.0% 0.0% 0.0% 0.0% 124 0 0 0.0% 0.0% 27.4%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.95 8.95 123.84 0.00 1.2016 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.97% 0.00 0 0 0
miss 0.0 0.03% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing ${$84721m1} Frost damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 842 3.2% 123.8 3.46sec 3074 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2295 4782 31.4% 0.0% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.84 0.00 0.00 123.84 0.0000 0.0000 380695
Tick Results Count Pct Average Min Max Total Damage
hit 84.9 68.60% 2295.47 2057 2934 194993
crit 38.8 31.36% 4782.21 4228 6029 185702
miss 0.1 0.05% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 4672 17.9% 61.1 7.39sec 34576 29605 0 34656 54837 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.10 60.99 0.00 0.00 1.1679 0.0000 2112683
Direct Results Count Pct Average Min Max Total Damage
crit 61.0 99.96% 34656.03 29816 54837 2112683
miss 0.0 0.04% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1045 4.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 169 2790 0 0.0% 0.0% 74.9%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 128.33 169.44 169.44 0.0000 2.0000 472727
Direct Results Count Pct Average Min Max Total Damage
hit 128.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 169.4 100.00% 2790.01 56 19671 472727

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:753.97
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 598
mirror_fire_blast 123 20.5% 34.2 33.49sec 1277 0 1228 1844 2437 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.21 34.21 0.00 0.00 0.0000 0.0000 43682
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.16% 1227.77 1105 1625 37454
crit 3.4 9.87% 1843.52 1657 2437 6227
miss 0.3 0.97% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 475 79.5% 85.5 12.81sec 1980 990 2116 3178 4167 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.54 76.98 0.00 0.00 2.0000 0.0000 169375
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.12% 2116.50 1912 2778 145205
crit 7.6 9.88% 3178.14 2867 4167 24170
miss 0.8 1.00% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2440
freeze 27 1.1% 17.0 27.42sec 707 0 540 1078 1172 32.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12016
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 66.92% 539.62 529 588 6139
crit 5.5 32.06% 1078.23 1055 1172 5877
miss 0.2 1.02% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2413 98.9% 205.7 2.19sec 5299 2414 4043 8140 10724 32.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.68 204.57 0.00 0.00 2.1949 0.0000 1089935
Direct Results Count Pct Average Min Max Total Damage
hit 136.3 66.63% 4042.64 3682 5376 551035
crit 66.2 32.36% 8139.71 7346 10724 538900
miss 2.1 1.01% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_T11_372
deep_freeze mana 4.4% 58.4 1567
frostbolt mana 82.8% 10.2 2037
frostfire_orb mana 1.5% 45.2 940
ice_lance mana 10.1% 36.8 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29501.0 16.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 1158.9 205720.8 177.5 0.0%
mana_gem mana 3.0 36305.7 12101.9 0.0%
master_of_elements mana 184.5 85687.8 464.5 0.0%
mp5_regen mana 1809.6 78718.2 43.5 0.0%
replenishment mana 1809.6 54352.5 30.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.3sec 187.3sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 27.7 7.0 16.0sec 12.7sec 18% 100%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 231.3 0.0 1.9sec 1.9sec 66% 66%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 46.6 46.5 9.8sec 4.9sec 65% 89%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.4sec 104.4sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.9 0.0 53.2sec 53.2sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.5 0.0 248.6sec 248.6sec 64% 64%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.6 0.0 277.7sec 277.7sec 36% 39%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.9sec 48.9sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 112.5sec 112.5sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 64.9sec 64.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.7 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 28.2 16.2sec
mana_gem 3.0 120.7sec
munched_ignite 26.4 15.9sec
rolled_ignite 11.7 34.5sec

Statistics & Data Analysis

DPS
Population
Convergence 69.79%
σ of the average dps 5.2752
2 * σ / μ 0.0405%
95% Confidence Intervall ( μ ± 2σ ) ( 26028.53 - 26049.63 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26023.26 - 26054.91 )
Sample Data
σ 527.5192
Minimum 24163.38
Maximum 28105.30
Spread ( max - min ) 3941.92
Range ( max - min ) / 2 1970.96
Range% 7.57
10th Percentile 25377.57
90th Percentile 26738.00
( 90th Percentile - 10th Percentile ) 1360.42
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1641
0.1 scale factor error with delta=300 2473
0.05 scale factor error with delta=300 9894
0.01 scale factor error with delta=300 247356
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*12)<target.time_to_die
M frostbolt
N ice_lance,moving=1
O fire_blast,moving=1

Sample Sequence

01359BJDEHMMIMJMMMMJMMIMMMMMMMIMJMMMHMMMIMJFGMMMMMJMMMMMKMJMMMMDIHCDGHAMMMMJMJJMJKKMJMMMMMMIMMLMHMMMMKMKJMMMIMMMBMMMDMJHMMKMJMMIMMMMMMJMJMMJMHIKMJMMMIMMMMMJMMEMDMKMHKJKKMKMJMMMMMIGMMMIMMMMMHIMMMJMMFMMMMMMMMBM4MMDMMMMMHIMJMJMMMMMIMMMMMMMMMMHMJMMMJMJMMMMLMDMKMKMJHKMJJMMMJMMMJMJMMIMMKMJHMMMMGMMMMMMEMMMJDIMMMKIJMHMMMJIMMIMMMMMIMMJIMMMMMFMMMMMMMMMHMMMDIMMMJMJMMMJMMIMJMHCDGJHMMIMMMJJMMJIMMMMMMMKJMMMHMMMMMMIMMMMMMMJIMMDMMHMIMJMMJMJMJKMJMMJMM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.96% 16.96% 1737
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.46% 14.46% 1737
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.23% 7.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_T11_372
origin="http://chardev.org/?profile=87885"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/frostbolt/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*12) actions+=/frostbolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1737
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Paladin_Retribution_T11_372 : 27414dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27414.0 15.53 / 0.06% 34.2 802.0 774.0 mana 6.03% 56.1
Origin http://chardev.org/?profile=47301
Talents http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
Glyphs
  • the_ascetic_crusader
  • hammer_of_wrath
  • templars_verdict
  • exorcism
  • seal_of_truth

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:31823|21877|21199|11503|9590|8123|8106|2690|2394&chds=0,63646&chco=C0C0C0,C0C0C0,C79C6E,C0C0C0,C79C6E,C0C0C0,C0C0C0,C79C6E,C79C6E&chm=t++31823++exorcism,C0C0C0,0,0,15|t++21877++hammer_of_wrath,C0C0C0,1,0,15|t++21199++templars_verdict,C79C6E,2,0,15|t++11503++consecration,C0C0C0,3,0,15|t++9590++crusader_strike,C79C6E,4,0,15|t++8123++holy_wrath,C0C0C0,5,0,15|t++8106++judgement_of_truth,C0C0C0,6,0,15|t++2690++melee,C79C6E,7,0,15|t++2394++melee,C79C6E,8,0,15&chtt=Paladin_Retribution_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:17,16,13,10,8,8,7,5,5,4,4,1,1,1,0&chds=0,100&chco=C79C6E,C0C0C0,C79C6E,C79C6E,C79C6E,C0C0C0,C0C0C0,C0C0C0,336600,C0C0C0,C0C0C0,C0C0C0,C79C6E,C0C0C0,C0C0C0&chl=templars_verdict|hand_of_light|crusader_strike|melee|seal_of_truth|exorcism|censure|hammer_of_wrath|darkmoon_card_hurricane|judgement_of_truth|seals_of_command|holy_wrath|melee|ancient_fury|consecration&chtt=Paladin_Retribution_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556876556544332111110zyyxxyyyyyzzyyyyxxxwwwwvvtrqolihfdbaabbbaaZZYYXXXYYXXXWWVVVUUUUUTTSSSSRRRRRRRRQQQQPPPQQQQQPPPPPPPPPONNOOOOOPPPQQQQRRRSSSSSSSSSSSSSSSTTUUUVVWWXXXXXXXXXWWWVVUUTTTTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSRSSSSSSSRRRRRRRRRRRRRRRRRRRRQPPPPPPQQRRRRRSSSTTTTTTTTTTTTTTTTTTTTUUUUUUVVVVVVWWWWWWWWWVVVVVVUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVUTSTTTTTTUUUUVVVVWWWWWWWWWWWWWWWWWWXXXXXXYYYYZZZZaaaabbbbbbbbbbbccccccccccccccddddddddddd&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=24568&chtt=Paladin_Retribution_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y011323354567676576456544210zwwvuvvutusrrpmlkjjjjkjjiiihhhghhghhgggffededddcccccccbbccccdddeeeeeeeeeeeeeeeeddddeefggghhhijjkklmmnoopooonnmmlkkjjiihhhhhhhhhiijjklllmmmmmmmmllkjjiihggfeedddccccbbbbbbccccccdddeeeffffffgffffffefeeeedddddeefffgghiijjkklmmnnonnnmmlllkjjjiiihihhhhhiiijjjkkklllllllkkkkkjjjjiiiiiiiiiijjjjkkkllmmnppppppooonnmmmlkkkjihffeeeeeeefffgghhiijkklmmnnooppppppoonmmmllkkkjjjiiiiiiijjjkkklllllmmmmmmmmmmmllllllkkkkkkkkkjkjjjjjjjjjjjjjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27414|max=45226&chxp=1,1,61,100&chtt=Paladin_Retribution_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,1,2,3,2,4,9,20,26,38,52,86,100,154,243,253,334,392,453,504,583,614,624,695,660,572,555,482,456,390,352,314,226,200,155,105,90,71,54,41,34,22,10,7,5,0,2,1,2&chds=0,695&chbh=5&chxt=x&chxl=0:|min=24380|avg=27414|max=30524&chxp=0,1,49,100&chtt=Paladin_Retribution_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Paladin_Retribution_T11_372 27414
ancient_fury 208 0.8% 3.0 210.50sec 31393 0 28577 59727 103079 9.7% 0.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 94180
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 89.63% 28577.29 0 52503 76841
crit 0.3 9.68% 59726.83 0 103079 17339
dodge 0.0 0.69% 0.00 0 0 0

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Fury, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.061000
  • base_dd_min:207.04
  • base_dd_max:280.11
censure 2025 7.4% 395.0 1.15sec 2318 0 0 0 0 0.0% 0.7% 0.0% 0.0% 196 4232 8716 9.9% 0.0% 99.8%

Stats details: censure

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
394.96 394.96 195.87 195.87 0.0000 2.3043 915410
Direct Results Count Pct Average Min Max Total Damage
hit 392.2 99.29% 0.00 0 0 0
dodge 2.8 0.71% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 176.6 90.15% 4231.81 693 6761 747199
crit 19.3 9.85% 8716.04 1427 13928 168211

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Holy damage every $t1 sec.
  • description:Holy damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
consecration 131 0.5% 4.3 94.72sec 13856 11503 0 0 0 0.0% 0.0% 0.0% 0.0% 53 1020 1575 17.2% 0.0% 9.3%

Stats details: consecration

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.26 4.26 52.91 52.91 1.2046 0.7913 59026
Direct Results Count Pct Average Min Max Total Damage
hit 4.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 43.8 82.76% 1019.80 750 1425 44656
crit 9.1 17.24% 1575.33 1159 2201 14370

Action details: consecration

Static Values
  • id:81297
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:81.33
  • base_dd_max:81.33
crusader_strike 3582 13.1% 111.6 4.04sec 14511 9590 11491 23680 33559 24.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
111.61 111.61 0.00 0.00 1.5131 0.0000 1619612
Direct Results Count Pct Average Min Max Total Damage
hit 84.0 75.23% 11491.26 10593 16291 964847
crit 27.7 24.77% 23679.82 21823 33559 654766

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1639.4
  • cooldown:3.72
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.35
darkmoon_card_hurricane 1262 4.6% 92.9 5.38sec 6143 0 5562 11457 11458 9.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
92.91 92.91 0.00 0.00 0.0000 0.0000 570705
Direct Results Count Pct Average Min Max Total Damage
hit 83.7 90.15% 5561.88 5150 5562 465805
crit 9.2 9.85% 11457.50 10609 11458 104900

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
divine_plea 0 0.0% 3.2 131.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_plea

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.21 3.21 0.00 0.00 1.1978 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.2 100.00% 0.00 0 0 0

Action details: divine_plea

Static Values
  • id:54428
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • description:You gain $o1% of your total mana over $d, but the amount healed by your healing spells is reduced by $s2%.
exorcism 2292 8.4% 27.5 15.88sec 37661 31823 28894 44672 65765 17.2% 0.0% 0.0% 0.0% 79 1931 2984 17.3% 0.0% 34.9%

Stats details: exorcism

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.51 27.51 78.86 78.86 1.1835 2.0000 1036115
Direct Results Count Pct Average Min Max Total Damage
hit 22.8 82.82% 28894.29 20656 42567 658342
crit 4.7 17.18% 44671.65 31914 65765 211154
Tick Results Count Pct Average Min Max Total Damage
hit 65.2 82.71% 1930.66 1380 2842 125930
crit 13.6 17.29% 2983.64 2132 4392 40689

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:7026.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Holy damage per $t2 sec.
  • description:Causes ${(($m1+$M1)/2)+(0.344*$cond($gt($SP,$AP),$SP,$AP))} Holy damage $?s54934[plus ${($m1+$M1)/2*0.0688} over $d ][]to an enemy target. If the target is Undead or Demon, it will always critically hit.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2590.76
  • base_dd_max:2892.33
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.066667
  • base_td:184.28
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
hammer_of_wrath 1421 5.2% 19.5 24.00sec 33019 21877 18986 39087 51898 69.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.46 19.46 0.00 0.00 1.5093 0.0000 642497
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 30.19% 18986.37 12395 25193 111526
crit 13.6 69.81% 39086.80 25533 51898 530971

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • tree:retribution
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • base_cost:-2810.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a hammer that strikes an enemy for $s1 Holy damage. Only usable on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:3814.27
  • base_dd_max:4215.78
hand_of_light 4251 15.5% 176.8 2.55sec 10869 0 10869 0 39962 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.82 176.82 0.00 0.00 0.0000 0.0000 1921847
Direct Results Count Pct Average Min Max Total Damage
hit 176.8 100.00% 10868.96 4240 39962 1921847

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:22697.83
  • base_dd_max:22697.83
holy_wrath 343 1.3% 15.9 26.30sec 9778 8123 8925 13798 18970 17.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.88 15.88 0.00 0.00 1.2036 0.0000 155287
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 82.51% 8925.03 6531 12278 116949
crit 2.8 17.49% 13798.41 10090 18970 38338

Action details: holy_wrath

Static Values
  • id:2812
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:4684.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:Sends bolts of holy power in all directions, causing ${0.61*$SPH+$m1} Holy damage divided among all targets within $a1 yds and stunning all Demons$?s56420[, Dragonkin, Elementals,][] and Undead for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.610000
  • base_dd_min:2435.78
  • base_dd_max:2435.78
inquisition 0 0.0% 12.2 38.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.16 12.16 0.00 0.00 1.1713 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • tree:retribution
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases Holy damage done by $s1%.
  • description:Consumes all Holy Power to increase your Holy Damage by $s1%. Lasts $d per charge of Holy Power consumed.
judgement_of_truth 979 3.6% 36.2 12.59sec 12236 8106 9934 20473 33880 21.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: judgement_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.18 36.18 0.00 0.00 1.5095 0.0000 442710
Direct Results Count Pct Average Min Max Total Damage
hit 28.3 78.16% 9934.47 5617 16447 280952
crit 7.9 21.84% 20473.19 11570 33880 161759

Action details: judgement_of_truth

Static Values
  • id:31804
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1171.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${1+0.223*$SPH+0.142*$AP} Holy damage to an enemy, increased by 10% for each application of Censure on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
melee 2684 9.8% 162.5 2.79sec 7468 2690 7150 14729 21084 9.9% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
162.50 162.50 0.00 0.00 2.7759 0.0000 1213577
Direct Results Count Pct Average Min Max Total Damage
hit 107.4 66.12% 7150.04 6573 10235 768254
crit 16.0 9.86% 14728.99 13539 21084 236023
glance 39.0 24.02% 5362.22 4929 7676 209300

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth 2326 8.5% 421.5 1.07sec 2495 0 2259 4654 6715 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
421.47 421.47 0.00 0.00 0.0000 0.0000 1051544
Direct Results Count Pct Average Min Max Total Damage
hit 380.0 90.17% 2259.45 358 3260 858642
crit 41.4 9.83% 4654.39 738 6715 192902

Action details: seal_of_truth

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3279.1
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
seals_of_command 976 3.6% 422.5 1.07sec 1045 0 946 1948 2798 9.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seals_of_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
422.48 422.48 0.00 0.00 0.0000 0.0000 441335
Direct Results Count Pct Average Min Max Total Damage
hit 380.8 90.14% 945.79 671 1358 360181
crit 41.6 9.86% 1948.47 1382 2798 81154

Action details: seals_of_command

Static Values
  • id:20424
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Seal of Righteousness, Seal of Truth and Seal of Justice now also deal $s1% weapon damage each time you swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.07
templars_verdict 4606 16.8% 65.2 6.85sec 31940 21199 25910 53380 76800 21.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
65.21 65.21 0.00 0.00 1.5067 0.0000 2082653
Direct Results Count Pct Average Min Max Total Damage
hit 50.9 78.05% 25910.37 23940 37281 1318664
crit 14.3 21.95% 53380.25 49317 76800 763989

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant weapon attack that causes a percentage of weapon damage. Consumes all charges of Holy Power to increase damage dealt: 1 Holy Power: $% Weapon Damage 2 Holy Power: $% Weapon Damage 3 Holy Power: $% Weapon Damage
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.35
pet - guardian_of_ancient_kings 445
melee 445 100.0% 34.0 9.99sec 4352 2394 4629 0 4629 0.0% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.00 34.00 0.00 0.00 1.8182 0.0000 147965
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 76.08% 4628.68 4629 4629 119734
glance 8.1 23.92% 3471.51 3472 3472 28231

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Paladin_Retribution_T11_372
consecration mana 15.1% 1.1 12882
crusader_strike mana 50.4% 8.9 1639
holy_wrath mana 20.5% 2.1 4684
inquisition holy_power 16.1% 0.0 2
judgement_of_truth mana 11.7% 10.4 1171
templars_verdict holy_power 83.9% 16668.4 2
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29275.7 16.2 0.8%
divine_plea mana 114.8 9615.1 83.7 0.0%
holy_power_crusader_strike holy_power 111.6 147.3 1.3 0.9%
initial_mana none 1.0 25122.0 25122.0 0.0%
judgements_of_the_bold mana 1339.9 194470.9 145.1 0.9%
mp5_regen mana 1809.6 105285.6 58.2 0.6%
replenishment mana 1809.6 11278.7 6.2 0.8%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 89.5 300.7sec 3.6sec 13% 100%

Database details

  • id:86700
  • cooldown name:buff_ancient_power
  • tooltip:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
avenging_wrath 4.3 0.0 121.1sec 121.1sec 19% 20%

Database details

  • id:31884
  • cooldown name:buff_avenging_wrath
  • tooltip:All damage and healing caused increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 9.1 0.0 52.6sec 52.6sec 30% 30%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
divine_plea 3.2 0.0 131.8sec 131.8sec 6% 6%

Database details

  • id:54428
  • cooldown name:buff_divine_plea
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
divine_purpose 27.8 0.4 15.9sec 15.6sec 12% 34%

Database details

  • id:90174
  • cooldown name:buff_divine_purpose
  • tooltip:Next Holy Power ability consumes no Holy Power and casts as if 3 Holy Power were used.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:15.00%
golemblood_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
inquisition 4.0 8.2 117.3sec 38.7sec 97% 98%

Database details

  • id:84963
  • cooldown name:buff_inquisition
  • tooltip:Increases Holy damage done by $s1%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_bold 19.0 17.2 24.3sec 12.6sec 74% 74%

Database details

  • id:89906
  • cooldown name:buff_judgements_of_the_bold
  • tooltip:Regaining ${$m1/10}% of your base mana per second.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.4 9.0 35.9sec 20.3sec 44% 45%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
the_art_of_war 27.8 4.7 16.1sec 13.7sec 22% 100%

Database details

  • id:
  • cooldown name:buff_the_art_of_war
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
zealotry 3.9 0.0 125.4sec 125.4sec 17% 17%

Database details

  • id:85696
  • cooldown name:buff_zealotry
  • tooltip:Crusader Strike generates 3 charges of Holy Power.
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
guardian_of_ancient_kings-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
censure

Database details

  • id:31803
  • cooldown name:buff_censure
  • tooltip:Holy damage every $t1 sec.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_pure

Database details

  • id:53657
  • cooldown name:buff_judgements_of_the_pure
  • tooltip:Casting and melee speed increased by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 92.9 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 71.14%
σ of the average dps 7.7636
2 * σ / μ 0.0566%
95% Confidence Intervall ( μ ± 2σ ) ( 27398.44 - 27429.50 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27390.68 - 27437.26 )
Sample Data
σ 776.3614
Minimum 24380.11
Maximum 30524.45
Spread ( max - min ) 6144.35
Range ( max - min ) / 2 3072.17
Range% 11.21
10th Percentile 26471.44
90th Percentile 28446.73
( 90th Percentile - 10th Percentile ) 1975.29
Approx. Iterations needed for
1% dps error 32
0.1% dps error 3208
0.1 scale factor error with delta=300 5357
0.05 scale factor error with delta=300 21430
0.01 scale factor error with delta=300 535766
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 seal_of_truth
3 snapshot_stats
4 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
5 auto_attack
6 judgement,if=buff.judgements_of_the_pure.down
7 guardian_of_ancient_kings
8 avenging_wrath,if=buff.zealotry.down
9 zealotry,if=buff.avenging_wrath.down
A inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
B templars_verdict,if=holy_power=3
C crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
D templars_verdict,if=buff.divine_purpose.react
E crusader_strike
F hammer_of_wrath
G exorcism,if=buff.the_art_of_war.react
H judgement,if=buff.judgements_of_the_pure.remains<2
I wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
J judgement
K holy_wrath
L consecration
M divine_plea

Sample Sequence

01245678AEFEKEBEFEGEBEFEGIIIIE9BEBEBEBEAGEBJCBBEGJEGKEBJCDDELJEBIIEKMEJIIIIIEABCDJEKDEBJEGLIIIIIEJIIIIIEBIIIIIEJIEKIIIIIEA8FEGJEFIIIEBIIEFJEKGEBJEIIIIIEJE9AGEBJEBGEBJEBGEBIIEJIIEKIIIIIEBJEGLEMJEAKEGJEIIIIIEBJEKIIIIIEGJCBBBEJIIEKAEBIIEJ8DEFDCBBEFDCDDEBDEJDAEKIIIIIE9BJEBIIEBDEBGCBBEB7GEJGEKAEBJEGDEGJCBBEKJELMEBIIIEJDEKIIIIIEAJEIIIIIEJEBK8EFJCDGEBFEGDEFGEAJEGKEJE9BIIEBIIEBIIEBJEBKEBGEGJELIIIIEADCDJEFIIIIIEBJEFDEGJEBDEFDEJFEAGEFJEKDEB8FEJLEFMEBJEFDCDG4EAFEJIIEFKE9BJEBFEBGCBBEBFEGJE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7109 5784 5345
Agility 699 117 20
Stamina 7711 6086 5930
Intellect 132 126 20
Spirit 141 141 20
Health 150923 128229 0
Mana 25122 25032 0
Spell Power 5442 3708 0
Spell Hit 17.47% 17.47% 970
Spell Crit 14.08% 9.07% 993
Spell Haste 10.90% 5.61% 719
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 16086 11974 190
Melee Hit 8.08% 8.08% 970
Melee Crit 14.64% 6.77% 993
Melee Haste 5.61% 5.61% 719
Expertise 23.15 13.15 395
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 6.42% 4.51% 83
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.06% 19.06% 1982

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
tabard empty

Talents

Holy Rank
Arbiter of the Light 2
Protector of the Innocent 0
Judgements of the Pure 3
Clarity of Purpose 0
Last Word 0
Blazing Light 2
Denounce 0
Divine Favor 0
Infusion of Light 0
Daybreak 0
Enlightened Judgements 0
Beacon of Light 0
Speed of Light 0
Sacred Cleansing 0
Conviction 0
Aura Mastery 0
Paragon of Virtue 0
Tower of Radiance 0
Blessed Life 0
Light of Dawn 0
Protection Rank
Divinity 0
Seals of the Pure 2
Eternal Glory 0
Judgements of the Just 0
Toughness 0
Improved Hammer of Justice 0
Hallowed Ground 0
Sanctuary 0
Hammer of the Righteous 0
Wrath of the Lightbringer 0
Reckoning 0
Shield of the Righteous 0
Grand Crusader 0
Vindication 0
Holy Shield 0
Guarded by the Light 0
Divine Guardian 0
Sacred Duty 0
Shield of the Templar 0
Ardent Defender 0
Retribution Rank
Eye for an Eye 2
Crusade 3
Improved Judgement 2
Guardian's Favor 0
Rule of Law 3
Pursuit of Justice 2
Communion 1
The Art of War 3
Long Arm of the Law 2
Divine Storm 1
Sacred Shield 1
Sanctity of Battle 1
Seals of Command 1
Sanctified Wrath 3
Selfless Healer 0
Repentance 1
Divine Purpose 2
Inquiry of Faith 3
Acts of Sacrifice 0
Zealotry 1

Profile

#!./simc

paladin=Paladin_Retribution_T11_372
origin="http://chardev.org/?profile=47301"
level=85
race=human
role=hybrid
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
glyphs=the_ascetic_crusader/hammer_of_wrath/templars_verdict/exorcism/seal_of_truth
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/seal_of_truth
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
actions+=/auto_attack
actions+=/judgement,if=buff.judgements_of_the_pure.down
actions+=/guardian_of_ancient_kings
actions+=/avenging_wrath,if=buff.zealotry.down
actions+=/zealotry,if=buff.avenging_wrath.down
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
actions+=/templars_verdict,if=holy_power=3
actions+=/crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
actions+=/templars_verdict,if=buff.divine_purpose.react
actions+=/crusader_strike
actions+=/hammer_of_wrath
actions+=/exorcism,if=buff.the_art_of_war.react
actions+=/judgement,if=buff.judgements_of_the_pure.remains<2
actions+=/wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
actions+=/judgement
actions+=/holy_wrath
actions+=/consecration
actions+=/divine_plea
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders=reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
chest=reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs=reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands=reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
# Gear Summary # gear_strength=5345
# gear_agility=20
# gear_stamina=5930
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=395
# gear_hit_rating=970
# gear_crit_rating=993
# gear_haste_rating=719
# gear_mastery_rating=1982
# gear_armor=21168
# gear_dodge_rating=83
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide

Priest_Disc_Smite_T11_372 : 11945dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
11944.5 115.60 / 0.97% 6.3 1897.1 1723.2 mana 23.48% 33.7
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGszRsbcRMo0hZhb0b
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:28884|25936|24120|17509|16504|12043|7982&chds=0,57767&chco=9482C9,9482C9,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9&chm=t++28884++devouring_plague,9482C9,0,0,15|t++25936++shadow_word_pain,9482C9,1,0,15|t++24120++power_word_shield,C0C0C0,2,0,15|t++17509++penance,C0C0C0,3,0,15|t++16504++holy_fire,C0C0C0,4,0,15|t++12043++smite,C0C0C0,5,0,15|t++7982++melee,9482C9,6,0,15&chtt=Priest_Disc_Smite_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:30,29,26,14,14,13,12,5,4,1&chds=0,100&chco=C0C0C0,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9,9482C9,C0C0C0,9482C9,C41F3B&chl=penance|atonement|smite|power_word_shield|holy_fire|shadow_word_pain|devouring_plague|divine_aegis|melee|darkmoon_card_volcano&chtt=Priest_Disc_Smite_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:r6445667654454323554200zxvuuvvvwyyyxwvuvvwzyxwwwwvttuutsppqpnnprrrrssspppppqpppqqpmmmnmljkkjjjkkkkmoqruxz12334677776531000zyz02220zz0112210zzyyxxxxvuuuutssstvvvwwwwvvvuuuuuuuusssrqqppononmmmmmnoppqqpoonmnnnnmlkjhggggghijiihghijiiihgfeeeddcbbaZYYYYYYYabbcccdcbaZZZYYYYYXXWWUUUUTTTTTTUTTTVWWWVUTSRRRRRRQQPPONMMMMNOOOOONOPPPOONMLKKKKJIHHHHGGGGGFGGHIJKKJJIHFFEEEEDDDCCBBBBBBBBBBBBBCCDDDDDDCCCBBBBBBBBDFHMPSWacfhjklmmmmmmllkjiiiijjjjjjhhgffeeefeeeedcccbbbbb&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=127186&chtt=Priest_Disc_Smite_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:0222345543445577441yvspmkjihhfeccbcbcdaZacdhikjhhfijkmkjihfghfhgecbcdbcbbbbcehhhfeedccddghkjkjlmonorsuuvvvwxwtsstsrolhifdefeedfedffecacehjkjjjhgijkihhfddefddbZaabbbbaaabdfhhgfeeffhggffefeeeeeeeefghhhhhgghiiihfecbaaccdddcccdeeedefhijkkjjiiiiigfedddeecbbcbcccbcccdefggfeddefeddddeeeeeeeffgghijihhiihhhgfdcaZYXYZZaabbcddeeeefhijjkjjiiihhgfeddcdddbbabbccbbaaabbbbaZYYYZZYYXXWXXYYYYYZZZZZZYYYYZZZZYXXXWWWXXYZabccddefghiikkklllkllllmmmllkjjiiiihhgfgffedccbcb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=11945|max=22175&chxp=1,1,54,100&chtt=Priest_Disc_Smite_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,0,1,2,3,3,6,21,30,42,68,107,114,143,208,285,327,417,442,423,469,502,494,510,507,512,537,521,530,495,530,407,348,269,200,171,122,88,57,33,24,13,7,2,6,0,1,1&chds=0,537&chbh=5&chxt=x&chxl=0:|min=15763|avg=11945|max=19414&chxp=0,1,-105,100&chtt=Priest_Disc_Smite_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Disc_Smite_T11_372 11945
archangel 0 0.0% 14.1 32.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.09 14.09 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.1 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
atonement 3517 29.4% 78.4 5.66sec 20290 0 17856 27892 44907 24.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: atonement

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.41 78.41 0.00 0.00 0.0000 0.0000 1590910
Direct Results Count Pct Average Min Max Total Damage
hit 59.4 75.75% 17855.51 12678 29066 1060459
crit 19.0 24.25% 27892.24 19588 44907 530452

Action details: atonement

Static Values
  • id:81751
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:(null)
  • description:When you deal damage with Smite, you instantly heal a nearby low health friendly party or raid target within $81751A yards from the enemy target equal to a percentage of the damage dealt.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:25117.01
  • base_dd_max:25117.01
darkmoon_card_volcano 72 0.6% 10.2 46.47sec 3216 0 2814 4350 4543 26.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.18 10.18 0.00 0.00 0.0000 0.0000 32749
Direct Results Count Pct Average Min Max Total Damage
hit 7.5 73.83% 2813.79 2773 2940 21157
crit 2.7 26.17% 4349.68 4284 4543 11592

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1396 11.7% 19.0 24.15sec 33154 28884 0 0 0 0.0% 0.0% 0.0% 0.0% 200 2782 4337 24.1% 0.0% 95.4%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.04 19.04 199.93 199.93 1.1479 2.1574 631227
Direct Results Count Pct Average Min Max Total Damage
hit 19.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.7 75.89% 2782.34 2566 3398 422123
crit 48.2 24.11% 4337.18 3965 5250 209103

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
divine_aegis 542 4.5% 19.0 23.13sec 12900 0 12900 0 24288 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.02 19.02 0.00 0.00 0.0000 0.0000 245322
Direct Results Count Pct Average Min Max Total Damage
hit 19.0 100.00% 12899.54 8645 24288 245322

Action details: divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Critical heals have a chance to create a protective shield on the target, absorbing a percentage of the amount healed. Lasts $d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:8473.63
  • base_dd_max:8473.63
holy_fire 1633 13.7% 38.7 11.81sec 19108 16504 11899 18530 23631 24.2% 0.0% 0.0% 0.0% 375 509 793 24.1% 0.0% 59.4%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.66 38.66 375.01 375.01 1.1578 0.7169 738737
Direct Results Count Pct Average Min Max Total Damage
hit 29.3 75.81% 11899.18 8408 15295 348759
crit 9.4 24.19% 18529.72 12991 23631 173284
Tick Results Count Pct Average Min Max Total Damage
hit 284.6 75.89% 509.42 363 656 144984
crit 90.4 24.11% 793.23 561 1014 71710

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.571000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
penance 3634 30.4% 37.9 11.97sec 43404 17509 0 0 0 0.0% 0.0% 0.0% 0.0% 155 9377 14592 24.3% 0.0% 18.7%

Stats details: penance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.87 37.87 154.70 154.39 2.4789 0.5460 1643668
Direct Results Count Pct Average Min Max Total Damage
none 37.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 116.8 75.67% 9377.49 6654 12142 1095471
crit 37.6 24.33% 14592.36 10281 18760 548197

Action details: penance_tick

Static Values
  • id:47666
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.458000
  • base_dd_min:699.38
  • base_dd_max:790.24

Action details: penance

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • tree:discipline
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2882.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
power_infusion 0 0.0% 4.3 121.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3294.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
power_word_shield 1692 14.2% 27.6 16.53sec 27687 24120 27687 0 37307 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.64 27.64 0.00 0.00 1.1479 0.0000 765285
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 100.00% 27686.78 25660 37307 765285

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $ damage. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.870000
  • base_dd_min:8136.94
  • base_dd_max:8136.94
shadow_fiend 0 0.0% 1.8 300.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.80 1.80 0.00 0.00 1.1856 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.8 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1590 13.3% 24.3 18.85sec 29650 25936 0 0 0 0.0% 0.0% 0.0% 0.0% 203 3116 4864 24.1% 0.0% 96.2%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.26 24.26 203.37 203.37 1.1432 2.1404 719336
Direct Results Count Pct Average Min Max Total Damage
hit 24.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 154.4 75.92% 3116.27 2882 3787 481143
crit 49.0 24.08% 4863.59 4452 5851 238193

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 3140 26.3% 78.4 5.66sec 18113 12043 15937 24907 39933 24.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.41 78.41 0.00 0.00 1.5039 0.0000 1420199
Direct Results Count Pct Average Min Max Total Damage
hit 59.4 75.75% 15937.01 11612 25847 946517
crit 19.0 24.25% 24907.18 17941 39933 473682

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 619
melee 619 100.0% 20.1 13.25sec 10791 7982 8040 21705 26819 23.6% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.07 20.07 0.00 0.00 1.3519 0.0000 216571
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 52.48% 8040.08 505 10057 84692
crit 4.7 23.62% 21705.22 1346 26819 102881
glance 4.8 23.90% 6045.38 379 7543 28999

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.3 58.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 1.5286 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Disc_Smite_T11_372
devouring_plague mana 10.1% 7.3 4561
holy_fire mana 11.0% 7.9 2434
penance mana 17.8% 10.8 4036
power_infusion mana 1.3% 0.0 2529
power_word_shield mana 14.5% 6.1 4509
shadow_word_pain mana 11.2% 7.5 3974
smite mana 34.0% 4.9 3725
Resource Gains Type Count mana Average Overflow
archangel mana 14.1 96789.3 6869.6 0.0%
blessing_of_might mana 1809.6 29372.1 16.2 0.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 3.8 10625.0 2777.2 0.0%
hymn_of_hope_max_mana mana 0.8 14566.6 18646.4 0.0%
initial_mana none 1.0 117810.0 117810.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.6 92699.8 51.2 0.4%
rapture mana 27.6 252001.5 9117.0 2.0%
replenishment mana 1809.6 60859.0 33.6 0.4%
shadow_fiend mana 20.1 86334.7 4301.6 0.6%
spirit_intellect_regen mana 1809.6 120287.3 66.5 0.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
borrowed_time 27.6 0.0 16.5sec 16.5sec 36% 27%

Database details

  • id:59888
  • cooldown name:buff_borrowed_time
  • tooltip:$s1% spell haste until next spell cast.
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:200.00%
casting 117.4 0.0 3.8sec 3.8sec 35% 35%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.5sec 46.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 14.1 0.0 32.1sec 32.1sec 55% 88%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 16.0 62.4 28.7sec 5.7sec 90% 84%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 0.8 3.0 0.0sec 1.6sec 2% 2%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.1sec 52.1sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_infusion 4.3 0.0 121.3sec 121.3sec 14% 14%

Database details

  • id:
  • cooldown name:buff_power_infusion
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.9sec 46.9sec 26% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 1.8 0.0 300.4sec 0.0sec 6% 6%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.2 0.1 118.4sec 107.8sec 5% 5%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 3.9 0.0 126.1sec 126.1sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
weakened_soul 27.6 0.0 16.5sec 16.5sec 90% 90%

Database details

  • id:6788
  • cooldown name:buff_weakened_soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 5.3 0.0 58.4sec 0.0sec 6% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 16.4%
holy_evangelism_1 8.6%
holy_evangelism_2 10.1%
holy_evangelism_3 12.6%
holy_evangelism_4 13.2%
holy_evangelism_5 39.1%

Procs

Count Interval
surge_of_light 2.4 107.4sec

Statistics & Data Analysis

DPS
Population
Convergence 5.97%
σ of the average dps 57.7976
2 * σ / μ 0.9678%
95% Confidence Intervall ( μ ± 2σ ) ( 11828.91 - 12060.10 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.03% - 100.97% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 11771.11 - 12117.90 )
Sample Data
σ 5779.7554
Minimum 15763.26
Maximum 19413.60
Spread ( max - min ) 3650.34
Range ( max - min ) / 2 1825.17
Range% 15.28
10th Percentile 17069.86
90th Percentile 18317.34
( 90th Percentile - 10th Percentile ) 1247.48
Approx. Iterations needed for
1% dps error 9365
0.1% dps error 936575
0.1 scale factor error with delta=300 296938
0.05 scale factor error with delta=300 1187753
0.01 scale factor error with delta=300 29693842
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 power_infusion
A archangel,if=buff.holy_evangelism.stack>=5
B power_word_shield,if=buff.weakened_soul.down
C holy_fire
D devouring_plague,if=remains<tick_time|!ticking
E shadow_word_pain,if=remains<tick_time|!ticking
F penance
G smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCDE5FGGGGGAGCGFBGGEGCDFBCFEAGGGCBDFGGECFBCDFAEGGBGCFGGECBDF6ACGFBEGGGCDF9GBCEFAGGGGBCDFGECFBCADEFGBGGCGF8GEBCDFAGGGCFBEGGDCFBECFAGGGGGBCDFE9GCFBAGCDEFGBGGCGFEBCDFAGGGGCFBEGDCFBECAFGGGGGBCDFECFBAGGGCDEFGB89GCFECBDAFGGGGCFEC67BCDEFGGGGCFBGAEGGDCFGGBGCFEDBCAFGGGEGCFBGDCF9EBAGGCFGGGGDBCEFCFABGEGGDCFGGBCF8E

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6994 6191 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 123660 113160 0
Spell Power 10695 8388 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 19.50% 13.27% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 3
Soul Warding 0
Renewed Hope 1
Power Infusion 1
Atonement 2
Inner Focus 1
Rapture 3
Borrowed Time 2
Reflective Shield 0
Strength of Soul 0
Divine Aegis 3
Pain Suppression 1
Train of Thought 2
Focused Will 0
Grace 2
Power Word: Barrier 1
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 3
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 0
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 2
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Disc_Smite_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033213011213200312021003000000000000000000302000200000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/power_infusion
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/power_word_shield,if=buff.weakened_soul.down
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/penance
actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Holy_Smite_AA_T11_372 : 8505dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
8505.3 6.45 / 0.08% 5.9 1438.3 1257.1 mana 44.73% 27.8
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGoZfuRrRkbkMdo0o
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://0.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:23474|20935|13704|12697|6801&chds=0,46948&chco=9482C9,9482C9,C0C0C0,C0C0C0,9482C9&chm=t++23474++devouring_plague,9482C9,0,0,15|t++20935++shadow_word_pain,9482C9,1,0,15|t++13704++holy_fire,C0C0C0,2,0,15|t++12697++smite,C0C0C0,3,0,15|t++6801++melee,9482C9,4,0,15&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:45,17,17,15,5,1&chds=0,100&chco=C0C0C0,9482C9,C0C0C0,9482C9,9482C9,C41F3B&chl=smite|shadow_word_pain|holy_fire|devouring_plague|melee|darkmoon_card_volcano&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:u6678764444311zywvtqoooomlmmmnnooopooooppoonlljjjijklmoqqstuwyz1122334543210yyyxwvvuvvvvvwwwwvutssstvvvuutssrqqpponnnnnmllllmmmmmnppommllkjjihhhgfgggggfeeeeffggijiihhgfdcbaZYYYYYYYYZZZZZZZaaabZYYXXWVVUUUTTTTTTSRQQQQQPPPPQRRQQQPONNMMMLLLLLLKJIIIIIHHHHIJJJIIIHHHGGGGFEEEDDDDDDDDDDDDEFFFEEDDCCCCCCCCCCCCCCCCCBBBCCCCCCCCBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCEHKQUYbegikkllllkkjiihhggfedcbaaZYXXXXXXYYYZZZZYYYZZZYXXWUUTSRRRRRQQQPPPQQQRSSSSSSSRRQPONNMLLLKKLLLLMMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=108315&chtt=Priest_Holy_Smite_AA_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13332468665456752yuroligfeaXUUUTVVWYZadefhlnoopqtvvtussqonljikjfeedccbaaaZZZZZaaZZXXXWVUUTTSTTUWWYabdeeddddeeffedbbZYXVUSSSTTTTUVWXYZZZZZZZZaaZYXXWWVTSSSSTVWYZZZZZZaaabbbbbaZZXWWUTSTSSTTUVWXZabccccddeeeeddccaZYXVVVVVWWWWWWXXYZZabccbbbbaaYYXWWWVVVWVWWWXXXWWWWXXXXXXWWUUTSSRRSSTTTTTTUUUUVVVVVVVVUUTSSRRQQQQQQQQPQPPPPPPPPPPQQQPPPPPPPPPPPPPPPQQRRSSTTUUUVWXZacdffhhijkkmnoopppponmljihfecbaZYXWVUUUUVVWWXYZaaaaaaZZZZZYXWVUTTTSSTTUWWXYYZZabbbccbbaaZZYXXWWVVUT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=8505|max=19708&chxp=1,1,43,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,1,1,2,8,5,7,11,15,30,35,53,68,99,116,163,181,278,287,346,411,432,476,542,616,589,620,614,571,543,531,449,428,358,288,225,180,128,108,67,46,23,16,15,3,3,3,4,0,1&chds=0,620&chbh=5&chxt=x&chxl=0:|min=7218|avg=8505|max=9703&chxp=0,1,52,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Holy_Smite_AA_T11_372 8505
archangel 0 0.0% 13.4 34.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.42 13.42 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 13.4 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
chakra 0 0.0% 10.8 43.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.81 10.81 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.8 100.00% 0.00 0 0 0

Action details: chakra

Static Values
  • id:14751
  • school:physical
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state for $81208d.
  • description:When activated, your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite will put you into a Chakra state for $81208d. |CFFFFFFFFSerenity (Heal, Flash Heal, Greater Heal, Binding Heal)|R Increases the critical effect chance of your direct healing spells by $81208s1%, and causes your direct heals to refresh the duration of your Renew on the target. |CFFFFFFFFSanctuary (Prayer of Healing, Prayer of Mending)|R Increases the healing done by your area of effect spells and Renew by $81206s1% and reduces the cooldown of your Circle of Healing by $/1000;81206m2 sec. |CFFFFFFFFChastise (Smite, Mind Spike)|R Increases your total damage done by Shadow and Holy spells by $81209s1%.
darkmoon_card_volcano 57 0.7% 10.1 46.82sec 2553 0 2663 4116 4287 20.8% 15.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 25814
Direct Results Count Pct Average Min Max Total Damage
hit 6.5 63.79% 2662.91 2629 2775 17177
crit 2.1 20.75% 4116.20 4062 4287 8637
miss 1.6 15.46% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1284 15.1% 20.8 22.10sec 27931 23474 0 0 0 0.0% 15.6% 0.0% 0.0% 180 2857 4450 22.7% 0.0% 90.5%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.80 20.80 180.48 180.48 1.1899 2.2683 580992
Direct Results Count Pct Average Min Max Total Damage
hit 17.6 84.44% 0.00 0 0 0
miss 3.2 15.56% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 139.5 77.29% 2857.30 2297 3457 398583
crit 41.0 22.71% 4450.47 3549 5341 182409

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
holy_fire 1408 16.6% 38.6 11.86sec 16521 13704 12438 19349 24678 19.0% 15.6% 0.0% 0.0% 302 534 831 22.5% 0.0% 51.1%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.56 38.56 302.20 302.20 1.2055 0.7650 637036
Direct Results Count Pct Average Min Max Total Damage
hit 25.2 65.45% 12438.31 7733 15973 313899
crit 7.3 18.97% 19349.29 11947 24678 141532
miss 6.0 15.58% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 234.4 77.55% 534.22 334 686 125195
crit 67.8 22.45% 831.46 517 1061 56409

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.571000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 2.0 300.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 1.2132 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1485 17.5% 27.1 16.86sec 24810 20935 0 0 0 0.0% 15.6% 0.0% 0.0% 187 3188 4962 22.5% 0.0% 93.8%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.08 27.08 187.31 187.31 1.1851 2.2640 671851
Direct Results Count Pct Average Min Max Total Damage
hit 22.9 84.44% 0.00 0 0 0
miss 4.2 15.56% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 145.2 77.49% 3187.55 2587 3862 462685
crit 42.2 22.51% 4961.63 3997 5967 209166

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 3819 44.9% 88.2 5.06sec 19584 12697 17376 27085 41431 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.20 88.20 0.00 0.00 1.5425 0.0000 1727333
Direct Results Count Pct Average Min Max Total Damage
hit 68.1 77.25% 17375.78 10600 26816 1183907
crit 20.1 22.75% 27085.17 16377 41431 543426

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 561
melee 561 100.0% 22.2 14.83sec 9208 6801 7330 19799 24133 22.1% 6.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.16 22.16 0.00 0.00 1.3538 0.0000 204076
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 47.95% 7330.12 505 9050 77904
crit 4.9 22.08% 19799.29 1346 24133 96868
glance 5.3 23.97% 5515.10 379 6787 29304
dodge 1.3 6.00% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 62.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.99 5.99 0.00 0.00 1.5302 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Holy_Smite_AA_T11_372
devouring_plague mana 14.8% 6.0 4632
holy_fire mana 14.9% 6.6 2506
shadow_word_pain mana 17.0% 6.1 4076
smite mana 53.4% 5.0 3936
Resource Gains Type Count mana Average Overflow
archangel mana 13.4 82392.0 6137.8 0.3%
blessing_of_might mana 1809.6 29433.7 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 5.0 12717.1 2544.6 0.0%
hymn_of_hope_max_mana mana 1.0 17231.4 17231.4 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.6 92892.6 51.3 0.2%
replenishment mana 1809.6 55234.1 30.5 0.2%
shadow_fiend mana 20.8 83106.1 3989.0 0.0%
spirit_intellect_regen mana 1809.6 179744.3 99.3 0.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.4sec 180.4sec 7% 11%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 127.1 0.0 3.6sec 3.6sec 39% 39%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_chastise 1.0 9.6 351.0sec 44.2sec 99% 98%

Database details

  • id:81209
  • cooldown name:buff_chakra_chastise
  • tooltip:Increases the damage done by your Shadow and Holy spells by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_pre 10.8 0.0 43.8sec 43.8sec 17% 19%

Database details

  • id:14751
  • cooldown name:buff_chakra_pre
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state for $81208d.
  • max_stacks:1
  • duration:-0.00
  • cooldown:30.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.8sec 46.8sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 13.4 0.0 34.0sec 34.0sec 52% 52%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 16.2 72.0 28.5sec 5.1sec 93% 82%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 1.0 4.0 0.0sec 1.6sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 9.9 0.0 47.7sec 47.7sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 2.0 0.0 300.3sec 0.0sec 7% 7%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.5 0.2 120.4sec 106.7sec 6% 6%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 4.0 0.0 124.9sec 124.9sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 6.0 0.0 62.5sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 18.8%
holy_evangelism_1 10.9%
holy_evangelism_2 12.2%
holy_evangelism_3 12.9%
holy_evangelism_4 14.3%
holy_evangelism_5 30.9%

Procs

Count Interval
surge_of_light 2.7 106.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.53%
σ of the average dps 3.2249
2 * σ / μ 0.0758%
95% Confidence Intervall ( μ ± 2σ ) ( 8498.90 - 8511.80 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 8495.67 - 8515.02 )
Sample Data
σ 322.4856
Minimum 7218.11
Maximum 9703.50
Spread ( max - min ) 2485.39
Range ( max - min ) / 2 1242.69
Range% 14.61
10th Percentile 8100.78
90th Percentile 8924.85
( 90th Percentile - 10th Percentile ) 824.06
Approx. Iterations needed for
1% dps error 57
0.1% dps error 5750
0.1 scale factor error with delta=300 924
0.05 scale factor error with delta=300 3697
0.01 scale factor error with delta=300 92441
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 chakra
A archangel,if=buff.holy_evangelism.stack>=5
B holy_fire
C devouring_plague,if=remains<tick_time|!ticking
D shadow_word_pain,if=remains<tick_time|!ticking
E smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BC5DDEEEEEAEEBEEEEEEDBCCBDAEE9EEBE6CCEDBBAEECCDDE9EBEBDDCAEEEBEEEDB9CBAEEDEEEBECBDAEEBEE9ECEDB8BDAECEEBEE9BDDDCBAEEEEEDEBCBDDAEEEB9ECBDDBEEB9EDBEBDCBE9EBE67BC8DEEAEEEEBEEED9BCBAEDEEEEBCEDBAEEBCEE9EDBBCCDEEEBEEAEEEE9BDEBCDABEEEBDE9BCDBE8E

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 1.40% 1.40% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 25.10% 19.14% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 0
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 2
Empowered Healing 3
Divine Fury 3
Desperate Prayer 1
Surge of Light 1
Inspiration 2
Divine Touch 2
Holy Concentration 2
Lightwell 1
Tome of Light 2
Rapid Renewal 1
Spirit of Redemption 1
Serendipity 2
Body and Soul 0
Chakra 1
Revelations 1
Blessed Resilience 0
Test of Faith 2
State of Mind 2
Circle of Healing 1
Guardian Spirit 1
Shadow Rank
Darkness 0
Improved Shadow Word: Pain 0
Veiled Shadows 1
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 0
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Holy_Smite_AA_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033210000000000000000233112221211201102211001000000000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/chakra
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Shadow_T11_372 : 27103dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27102.8 9.84 / 0.04% 17.2 1572.2 1589.8 mana 0.00% 37.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
Glyphs
  • spirit_tap
  • inner_fire
  • psychic_scream
  • fading
  • fortitude
  • levitate
  • shadow_word_pain
  • shadow_word_death
  • mind_flay

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:81607|65261|35445|30185|25695|23321|21573|11611|7295&chds=0,163213&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++81607++devouring_plague,9482C9,0,0,15|t++65261++vampiric_touch,9482C9,1,0,15|t++35445++mind_blast_3,9482C9,2,0,15|t++30185++mind_blast_2,9482C9,3,0,15|t++25695++mind_blast_1,9482C9,4,0,15|t++23321++shadow_word_death,9482C9,5,0,15|t++21573++mind_blast_0,9482C9,6,0,15|t++11611++mind_flay,9482C9,7,0,15|t++7295++melee,9482C9,8,0,15&chtt=Priest_Shadow_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x330&cht=p&chf=bg,s,333333&chd=t:29,20,11,10,6,5,4,4,4,3,3,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B&chl=mind_flay|vampiric_touch|shadow_word_pain|devouring_plague|mind_blast_3|melee|mind_blast_2|shadow_word_death|shadowy_apparition|mind_blast_1|devouring_plague_burst|mind_blast_0|darkmoon_card_volcano&chtt=Priest_Shadow_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ckkkllmou5678420xwvupnmlkkkkjjihhhhhggffffffeedcbbbbbaaaaZZZYYYYYXXXXXWWVVVVUUUVVVVVVVVVVWWWWWWVVWWYacfhhjjjjjjjjjjiihhggggffffffeedddcccccbbaaZZZYYYYXXXXXXXWWWWVVVVUUUUUUUUUUUUUUUUUUUUUUTTTUWYbcdeffgggffffffffeeddcccbbbbbbaaaaaZZZYYXXWWWWWVVVVVUUUUUUUUUUTTSSSRRRRRRRRRRRRRRRRRSSSRRSTUWYabcdddddddddddddcccbbbbbbbbbbaaaaaaaaaaaZZZZZZZZZZZZZZZaaaaaaaaaZZZZZZZZZZZZZZZZaaaaaabbcegijkllllllkkkkkkkkkjjjiiiiijjjjjjjjjjjjkkkkkkkkkklllmmmmmmmmmmmmmmmmlllllll&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=168326&chtt=Priest_Shadow_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uxx222121114578655321zxwssqrqqoomlkklkjiiiiihihighgggghhhgghhhhggggfffffffffeeeeddefffffgggghhiiijjkkkklkkkkkkkkkjjiihhgggfffeeeeeeeeeeeeffgggghhhhhhhhhhhhiiihhhgggggggggggggfggghhiijjkklllmmmmmmmmmllllkkjiihhgggggffffeeeddeeeeffffffggggghhhhhhhhhhhhhgggggggggfffffffffgghhhhhhiiijjjkkkkklkkkkkkkkjjiihhgggfffffffeeefffffgghhhiiiijjjjjjjjjjjjjjiiiihhhhhhhhhiiiiijjkllmmnnooppqqqqqqqqqqpppoonmmmllkkkjjiiihhhhhhiiiiijjjkkkllllmmmmmmmmllllllkkjjjjjjjiiii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27103|max=45641&chxp=1,1,59,100&chtt=Priest_Shadow_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,3,0,1,9,19,23,33,60,59,95,136,171,210,271,324,367,439,487,566,625,568,576,608,556,547,498,468,388,371,293,247,215,179,150,111,83,58,52,36,31,24,9,13,5,2,4,3,4&chds=0,625&chbh=5&chxt=x&chxl=0:|min=25360|avg=27103|max=29010&chxp=0,1,48,100&chtt=Priest_Shadow_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Shadow_T11_372 27103
archangel 0 0.0% 5.3 92.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.30 5.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
darkmoon_card_volcano 79 0.3% 10.2 46.26sec 3505 0 3086 4773 5217 24.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 35864
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 75.17% 3086.44 3023 3377 23739
crit 2.5 24.83% 4773.24 4671 5217 12125

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 4236 15.6% 20.2 22.87sec 94667 81607 0 0 0 0.0% 0.0% 0.0% 0.0% 203 4710 9903 22.5% 0.0% 99.0%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 203.48 203.48 1.1600 2.2009 1196550
Direct Results Count Pct Average Min Max Total Damage
hit 20.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 157.6 77.46% 4710.07 3527 7073 742441
crit 45.9 22.54% 9902.92 7371 14783 454109

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4786.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
devouring_plague_burst 795 2.9% 20.2 22.87sec 17771 0 14252 30004 44363 22.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 0.00 0.00 0.0000 0.0000 359661
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 77.66% 14252.23 10585 21227 223997
crit 4.5 22.34% 30004.26 22122 44363 135664

Action details: devouring_plague_burst

Static Values
  • id:0
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5847.06
  • base_dd_max:5847.06
mind_blast_0 315 1.2% 5.7 73.02sec 25188 21573 20030 42481 61859 23.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_0

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.66 5.66 0.00 0.00 1.1676 0.0000 142625
Direct Results Count Pct Average Min Max Total Damage
hit 4.4 77.02% 20029.52 17287 29598 87357
crit 1.3 22.98% 42481.41 36130 61859 55268

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_1 879 3.2% 13.1 33.03sec 30269 25695 24129 50974 85225 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_1

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.14 13.14 0.00 0.00 1.1780 0.0000 397597
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 77.13% 24129.37 20772 40778 244462
crit 3.0 22.87% 50973.67 43413 85225 153135

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_2 1086 4.0% 13.8 30.46sec 35654 30185 28445 60221 108591 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_2

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.77 13.77 0.00 0.00 1.1812 0.0000 490982
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 77.31% 28445.17 24256 51957 302850
crit 3.1 22.69% 60221.42 50695 108591 188132

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_3 1553 5.7% 16.9 25.27sec 41632 35445 33237 70340 131957 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_3

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.87 16.87 0.00 0.00 1.1745 0.0000 702298
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 77.37% 33237.11 27740 63137 433824
crit 3.8 22.63% 70339.98 57977 131957 268474

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_flay 7830 28.9% 123.0 3.64sec 28783 11611 0 0 0 0.0% 0.0% 0.0% 0.0% 368 7347 15521 27.8% 0.0% 60.7%

Stats details: mind_flay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.03 123.03 368.10 368.10 2.4789 0.7453 3541064
Direct Results Count Pct Average Min Max Total Damage
hit 123.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 265.7 72.19% 7346.86 6348 11550 1952374
crit 102.4 27.81% 15520.76 13267 24139 1588690

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1647.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement speed slowed.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d and slowing their movement speed by $s2%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.257000
  • base_td:167.30
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 5.3 91.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 1.1383 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_death 1065 3.9% 17.6 6.32sec 27373 23321 21821 46063 67863 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.60 17.60 0.00 0.00 1.1737 0.0000 481729
Direct Results Count Pct Average Min Max Total Damage
hit 13.6 77.10% 21820.94 18828 32471 296071
crit 4.0 22.90% 46063.33 39351 67863 185658

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2297.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s1 Shadow damage to the target. Deals three times as much damage to targets below 25% health. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.282000
  • base_dd_min:301.52
  • base_dd_max:301.52
shadow_word_pain 4083 15.1% 1.0 411.94sec 1840913 1774454 0 0 0 0.0% 0.0% 0.0% 0.0% 202 5504 11619 22.8% 0.0% 99.8%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 202.19 202.19 1.0375 2.2325 1394481
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 156.1 77.22% 5503.60 4172 7893 859226
crit 46.1 22.78% 11619.40 8719 16497 535255

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowy_apparition 1000 3.7% 28.9 15.41sec 15646 0 12303 25973 33601 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.90 27.85 0.00 0.00 0.0000 0.0000 452139
Direct Results Count Pct Average Min Max Total Damage
hit 19.8 71.26% 12302.86 11165 16077 244193
crit 8.0 28.74% 25972.73 23334 33601 207945

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you deal periodic damage with your Shadow Word: Pain, you have a chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal shadow damage. While moving, the chance to summon the shadowy apparation is increased.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.515000
  • base_dd_min:516.19
  • base_dd_max:516.19

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch 5488 20.2% 32.4 14.09sec 76620 65261 0 0 0 0.0% 0.0% 0.0% 0.0% 200 9902 20864 22.7% 0.0% 98.3%

Stats details: vampiric_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.39 32.39 200.23 200.23 1.1741 2.2193 2481976
Direct Results Count Pct Average Min Max Total Damage
hit 32.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 154.7 77.26% 9902.38 7266 14725 1531790
crit 45.5 22.74% 20863.96 15185 30776 950186

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3294.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $o2 Shadow damage over $d to your target and causes up to 10 party or raid members to gain 1% of their maximum mana per 10 sec when you deal damage from Mind Blast.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.400000
  • base_td:108.70
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - shadow_fiend 1410
melee 1410 100.0% 58.6 7.07sec 9904 7295 7466 20315 26754 22.4% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.60 58.60 0.00 0.00 1.3577 0.0000 580399
Direct Results Count Pct Average Min Max Total Damage
hit 31.4 53.62% 7465.73 505 10033 234611
crit 13.1 22.40% 20315.18 1346 26754 266684
glance 14.1 23.98% 5630.11 379 7525 79105

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 15.7 27.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.70 15.70 0.00 0.00 1.5328 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Shadow_T11_372
devouring_plague mana 13.6% 19.8 4786
mind_blast_0 mana 2.8% 7.2 3500
mind_blast_1 mana 6.5% 8.6 3500
mind_blast_2 mana 6.8% 10.2 3500
mind_blast_3 mana 8.3% 11.9 3500
mind_flay mana 28.5% 17.5 1647
shadow_word_death mana 5.7% 11.9 2297
shadow_word_pain mana 0.6% 437.2 4211
vampiric_touch mana 15.0% 23.3 3294
Resource Gains Type Count mana Average Overflow
archangel mana 5.3 186314.1 35137.0 2.9%
blessing_of_might mana 1809.6 28211.9 15.6 4.4%
dispersion mana 0.0 283.9 7551.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
masochism mana 17.6 154422.9 8774.7 12.9%
mp5_regen mana 1809.6 89061.0 49.2 4.3%
replenishment mana 1809.6 53459.3 29.5 4.5%
shadow_fiend mana 58.6 201399.8 3436.7 11.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.4sec 181.4sec 7% 9%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 82.0 0.0 5.5sec 5.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_archangel 5.3 0.0 92.5sec 92.5sec 21% 23%

Database details

  • id:87153
  • cooldown name:buff_dark_archangel
  • tooltip:Damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death increased by $w1%.
  • max_stacks:1
  • duration:18.00
  • cooldown:90.00
  • default_chance:100.00%
dark_evangelism 6.3 484.8 75.9sec 0.9sec 98% 96%

Database details

  • id:81661
  • cooldown name:buff_dark_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
empowered_shadow 1.0 48.4 378.1sec 9.2sec 99% 98%

Database details

  • id:95799
  • cooldown name:buff_empowered_shadow
  • tooltip:$w1% increased periodic shadow damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
glyph_of_shadow_word_death 8.8 0.0 13.2sec 13.2sec 11% 11%

Database details

  • id:
  • cooldown name:buff_glyph_of_shadow_word_death
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 52.0sec 52.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 10.1 0.0 47.0sec 47.0sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
self_movement 8.9 0.0 13.1sec 13.1sec 5% 5%

Database details

  • id:
  • cooldown name:buff_self_movement
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_orb 44.3 58.4 10.2sec 4.4sec 58% 89%

Database details

  • id:77487
  • cooldown name:buff_shadow_orb
  • tooltip:Consumed to increase damage done by Mind Blast or Mind Spike.
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend 5.3 0.0 91.9sec 0.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.2 0.0 117.3sec 117.3sec 18% 18%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.7sec 414.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 2%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 15.7 0.0 27.6sec 0.0sec 16% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_form

Database details

  • id:
  • cooldown name:buff_shadow_form
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace

Database details

  • id:
  • cooldown name:buff_vampiric_embrace
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 4.3%
dark_evangelism_1 0.1%
dark_evangelism_2 0.8%
dark_evangelism_3 0.7%
dark_evangelism_4 2.5%
dark_evangelism_5 91.5%
holy_evangelism_0 100.0%
mind_spike_0 100.0%
shadow_orb_0 11.5%
shadow_orb_1 26.6%
shadow_orb_2 27.9%
shadow_orb_3 34.1%

Procs

Count Interval
shadowy_apparation_proc 28.9 15.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.42%
σ of the average dps 4.9191
2 * σ / μ 0.0363%
95% Confidence Intervall ( μ ± 2σ ) ( 27092.91 - 27112.59 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27087.99 - 27117.51 )
Sample Data
σ 491.9054
Minimum 25359.60
Maximum 29009.78
Spread ( max - min ) 3650.18
Range ( max - min ) / 2 1825.09
Range% 6.73
10th Percentile 26503.59
90th Percentile 27760.28
( 90th Percentile - 10th Percentile ) 1256.68
Approx. Iterations needed for
1% dps error 13
0.1% dps error 1317
0.1 scale factor error with delta=300 2150
0.05 scale factor error with delta=300 8603
0.01 scale factor error with delta=300 215085
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 shadow_form
5 vampiric_embrace
6 snapshot_stats
7 volcanic_potion,if=!in_combat
8 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 mind_blast,if=buff.shadow_orb.stack>=1
A berserking
B shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains<gcd+0.5)&miss_react
C devouring_plague,if=(!ticking|dot.devouring_plague.remains<gcd+1.0)&miss_react
D stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains<cast_time+2.5
E vampiric_touch,if=(!ticking|dot.vampiric_touch.remains<cast_time+2.5)&miss_react
F start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
G archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
H shadow_word_death,health_percentage<=25
I shadow_fiend
J mind_blast
K mind_flay
L dispersion,moving=1
M devouring_plague,moving=1,if=mana_pct>10
N shadow_word_death,moving=1
O dispersion

Sample Sequence

013457ABCEIJKKGKK9KEKK9KCKK9EKKK9KKK9ECKK9KKEK9KKCK9EIKK9KKEK9CKK9EGKKKJKKCE9KKK9KEKKJKCKE9KKK9KEKC9KIKEJKKKAJKKCE9KKGK9KEKK9KCKEJKKK9KEKC9KKK9EKKK9KCEK9KIKK9EKKC9KKEGKJKKK9EKCK9KKEK9KKK9CEKK9KKEK9KCKK9EKAKK9IKEKCJKGKK9KEKKJKCKE9KKKFHHD9EKKC9FHHDKEK9KFHHDK9ECKK9FHHDKEK9KFHHDK9CEGIKFHHD9KKE9FHHDKCK9EKFHHDK9K8KE9CFHHDKK9EKFHHDK9KECK9AFHHDK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 23897 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 2
Evangelism 2
Archangel 1
Inner Sanctum 2
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 0
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 2
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 3
Improved Devouring Plague 2
Twisted Faith 2
Shadowform 1
Phantasm 0
Harnessed Shadows 2
Silence 0
Vampiric Embrace 1
Masochism 2
Mind Melt 2
Pain and Suffering 2
Vampiric Touch 1
Paralysis 0
Psychic Horror 0
Sin and Punishment 2
Shadowy Apparition 3
Dispersion 1

Profile

#!./simc

priest=Priest_Shadow_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
glyphs=spirit_tap/inner_fire/psychic_scream/fading/fortitude/levitate/shadow_word_pain/shadow_word_death/mind_flay
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/shadow_form
actions+=/vampiric_embrace
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mind_blast,if=buff.shadow_orb.stack>=1
actions+=/berserking
actions+=/shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains actions+=/devouring_plague,if=(!ticking|dot.devouring_plague.remains actions+=/stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains actions+=/vampiric_touch,if=(!ticking|dot.vampiric_touch.remains actions+=/start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
actions+=/archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
actions+=/shadow_word_death,health_percentage<=25
actions+=/shadow_fiend
actions+=/mind_blast
actions+=/mind_flay
actions+=/dispersion,moving=1
actions+=/devouring_plague,moving=1,if=mana_pct>10
actions+=/shadow_word_death,moving=1
actions+=/dispersion
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Rogue_Assassination_T11_372 : 27278dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27278.1 11.99 / 0.04% 1022.6 26.7 26.5 energy 42.07% 36.3
Origin http://chardev.org/?profile=36311
Talents http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
Glyphs
  • expose_armor
  • mutilate
  • backstab
  • rupture

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27548|18349|16516|14310|10457|3224|1610&chds=0,55097&chco=336600,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E&chm=t++27548++envenom,336600,0,0,15|t++18349++garrote,C55D54,1,0,15|t++16516++mutilate,C79C6E,2,0,15|t++14310++backstab,C79C6E,3,0,15|t++10457++rupture,C55D54,4,0,15|t++3224++melee_main_hand,C79C6E,5,0,15|t++1610++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Assassination_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,14,12,10,10,9,7,6,4,2,1&chds=0,100&chco=336600,336600,C79C6E,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54&chl=instant_poison|envenom|melee_main_hand|deadly_poison|venomous_wound|backstab|mutilate_mh|melee_off_hand|mutilate_oh|rupture|garrote&chtt=Rogue_Assassination_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:m2681uwvsturtrtsolmkjhedcbbbbbXWXXYYZaabbbbbbbbbbcbbaYXXWVVVVUUUUUUUUUUUUUUUUTUUUUUVVVVVVVVVVVVVVUUUVUUUUUUUUUUUUUUUUUUUUUVXWVVVVWWXXXWWWWWWWVVVVVVUUUUUUUUUUUUUUVUVVVVVVVVVVVVVUUUUUVVVVVWWWWWVVVUVUUUUUUUUUUUUUUTTTTTTTUUUVVWWXXXYYYYYYZYYYYYYXXYabZYXXYYYYZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZaaaaaaaaaabbbbbbcccccccdddddddddddeddddddeeeeeeeeeeeeeeeeeefgillkjiiiiiiiiiiiiiiiiiiihhhhgfeddddefghiklmnopqrrssrrqponmlkjjiihhggggfffffffffffffeeeeee&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=101&chtt=Rogue_Assassination_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z0221233443467877421zxwuutrqponnnmmllkkkjjjiiiihhgfffeedddcccbbbbbaaaaaaaabbbbbbbbccccccccccccccccbbbbbbbbaaaaaaaabbbcccddeeefffggghhhihhhhhhhhggffffeeeedddddcccccccccccccccccccdddddddcccccccccccbbbbbaaaaaaaaaabbbbcccdddeeeffffggggffffgggggghhhhhiiijjjjkkkkkjjjjjjiihhhggfffeeeddddccccccccccccccccccccccccddddddddeeeeeeeeeffffffffffffffffffeeeeeeeeeeeffffgghiijjkklllmmnnoooppppooooonnnmmmmlllllllllllllllmmmmmmmmmlllkkkjjjiihhhhgggggggggfffffffffffffg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27278|max=49429&chxp=1,1,55,100&chtt=Rogue_Assassination_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,0,1,2,2,3,6,16,21,34,60,71,83,131,172,233,277,321,415,462,478,591,654,639,622,626,612,523,488,462,392,335,286,226,203,152,122,86,73,39,24,22,11,5,4,6,4,3&chds=0,654&chbh=5&chxt=x&chxl=0:|min=24777|avg=27278|max=29505&chxp=0,1,53,100&chtt=Rogue_Assassination_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Assassination_T11_372 27278
backstab 2475 9.1% 76.6 2.08sec 14624 14310 8262 19705 25502 59.1% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
76.56 76.56 0.00 0.00 1.0219 0.0000 1119531
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 36.04% 8262.39 7521 10724 227968
crit 45.2 59.10% 19704.83 17886 25502 891563
dodge 3.7 4.86% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
deadly_poison 2847 10.4% 346.6 1.30sec 3717 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 8023 12396 13.1% 0.0% 99.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
346.57 1.02 149.88 149.88 0.0000 3.0000 1288059
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 130.3 86.94% 8023.26 1449 10870 1045490
crit 19.6 13.06% 12396.01 2558 16794 242569

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
envenom 3938 14.4% 62.9 7.16sec 28325 27548 20413 43357 63153 38.8% 4.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.90 62.90 0.00 0.00 1.0282 0.0000 1781537
Direct Results Count Pct Average Min Max Total Damage
hit 35.5 56.40% 20413.02 8076 30657 724172
crit 24.4 38.77% 43357.20 16638 63153 1057365
dodge 3.0 4.82% 0.00 0 0 0

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deadly Poison application chance increased by $s3%. Instant Poison application frequency increased by $s2%.
  • description:Finishing move that consumes your Deadly Poison and deals instant poison damage. Following the Envenom attack your Deadly Poison application chance is increased by $s3%, and your Instant Poison application frequency by $s2%, for 1 sec plus an additional 1 sec per combo point. Poison doses, up to the number of combo points spent, are consumed to increase Envenom's damage: 1 point : ${$AP*0.09*$+($m1*1)} damage 2 points: Up to ${$AP*0.18*$+($m1*2)} damage 3 points: Up to ${$AP*0.27*$+($m1*3)} damage 4 points: Up to ${$AP*0.36*$+($m1*4)} damage 5 points: Up to ${$AP*0.45*$+($m1*5)} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.270000
  • base_dd_min:722.40
  • base_dd_max:722.40
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
garrote 160 0.6% 3.8 128.56sec 19027 18349 0 0 0 0.0% 4.9% 0.0% 0.0% 21 2613 5418 27.4% 0.0% 14.2%

Stats details: garrote

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.80 3.80 21.36 21.36 1.0369 3.0000 72230
Direct Results Count Pct Average Min Max Total Damage
hit 3.6 95.13% 0.00 0 0 0
dodge 0.2 4.87% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 15.5 72.61% 2612.85 2341 3587 40523
crit 5.9 27.39% 5418.17 4823 7044 31706

Action details: garrote

Static Values
  • id:703
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for $1330d and causing ${($m1+$AP*$*0.07)*6} damage over $d, increased by your attack power. Must be stealthed and behind the target. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.070000
  • base_td:132.78
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 6655 24.4% 673.2 0.70sec 4472 0 4175 6450 8655 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
673.18 673.18 0.00 0.00 0.0000 0.0000 3010705
Direct Results Count Pct Average Min Max Total Damage
hit 585.1 86.92% 4174.84 3736 5602 2442858
crit 88.0 13.08% 6449.90 5773 8655 567847

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3221 11.8% 461.5 0.98sec 3157 3224 2977 6167 8086 26.9% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
461.51 461.51 0.00 0.00 0.9794 0.0000 1457200
Direct Results Count Pct Average Min Max Total Damage
hit 149.3 32.35% 2977.09 2695 3925 444509
crit 124.0 26.87% 6166.74 5551 8086 764591
glance 110.8 24.02% 2238.24 2021 2944 248100
dodge 22.4 4.86% 0.00 0 0 0
miss 54.9 11.90% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1609 5.9% 592.5 0.76sec 1229 1610 1158 2399 3146 26.9% 16.7% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
592.50 592.50 0.00 0.00 0.7631 0.0000 727980
Direct Results Count Pct Average Min Max Total Damage
hit 191.8 32.37% 1158.22 1048 1527 222132
crit 159.2 26.87% 2399.33 2160 3146 381940
glance 142.3 24.02% 870.81 786 1145 123909
dodge 28.7 4.85% 0.00 0 0 0
miss 70.5 11.90% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 2967 10.9% 79.4 3.65sec 16912 16516 0 0 0 0.0% 4.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.37 79.37 0.00 0.00 1.0239 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 75.5 95.16% 0.00 0 0 0
dodge 3.8 4.84% 0.00 0 0 0

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
mutilate_mh 1979 7.3% 75.5 3.84sec 11853 0 7182 17147 22115 46.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.53 75.53 0.00 0.00 0.0000 0.0000 895292
Direct Results Count Pct Average Min Max Total Damage
hit 40.1 53.12% 7182.28 6476 9300 288172
crit 35.4 46.88% 17146.80 15399 22115 607120

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
mutilate_oh 988 3.6% 75.5 3.84sec 5918 0 3585 8559 11034 46.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.53 75.53 0.00 0.00 0.0000 0.0000 447011
Direct Results Count Pct Average Min Max Total Damage
hit 40.1 53.09% 3585.05 3230 4640 143767
crit 35.4 46.91% 8559.44 7680 11034 303245

Action details: mutilate_oh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
rupture 673 2.5% 28.5 16.06sec 10688 10457 0 0 0 0.0% 4.9% 0.0% 0.0% 217 1093 2257 26.7% 0.0% 95.8%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.48 28.48 216.73 216.73 1.0221 2.0000 304409
Direct Results Count Pct Average Min Max Total Damage
hit 27.1 95.12% 0.00 0 0 0
dodge 1.4 4.88% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 158.8 73.26% 1093.16 572 1765 173562
crit 58.0 26.74% 2257.47 1178 3636 130847

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:182.29
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 1.0 184.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0050 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds
venomous_wound 2732 10.0% 142.7 3.15sec 8664 0 8089 12497 16875 13.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.67 142.67 0.00 0.00 0.0000 0.0000 1236132
Direct Results Count Pct Average Min Max Total Damage
hit 124.1 86.95% 8089.14 7280 10923 1003506
crit 18.6 13.05% 12496.79 11247 16875 232626

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.176000
  • base_dd_min:675.14
  • base_dd_max:675.14

Resources

Resource Usage Type Res% DPR RPE
Rogue_Assassination_T11_372
backstab energy 38.1% 243.7 60
envenom energy 18.2% 809.3 35
garrote energy 1.4% 422.8 45
mutilate energy 36.2% 307.5 55
rupture energy 5.9% 427.5 25
slice_and_dice energy 0.2% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 45.2 226.2 5.0 0.0%
cold_blood energy 4.1 102.0 24.8 0.7%
energy_refund energy 192.6 622.4 3.2 2.1%
energy_regen energy 1809.6 5366.4 3.0 0.5%
murderous_intent energy 72.8 2185.1 30.0 0.0%
overkill energy 299.6 292.8 1.0 2.8%
relentless_strikes energy 71.9 1796.8 25.0 0.0%
venomous_vim energy 142.7 1411.5 9.9 1.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cold_blood 4.1 0.0 124.7sec 124.7sec 0% 0%

Database details

  • id:
  • cooldown name:buff_cold_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:120.00
  • default_chance:100.00%
deadly_proc 341.5 0.0 1.3sec 1.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
envenom 53.9 9.0 8.3sec 7.2sec 73% 75%

Database details

  • id:
  • cooldown name:buff_envenom
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.5 7.2 38.7sec 23.3sec 39% 40%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.9 45.7sec 31.4sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overkill 3.8 0.0 128.6sec 128.6sec 17% 17%

Database details

  • id:
  • cooldown name:buff_overkill
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 1.0 345.5 305.5sec 1.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.7sec 78.7sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
slice_and_dice 1.0 59.9 140.7sec 7.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:21.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.1 0.6 50.2sec 46.1sec 8% 13%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 2.8 0.0 182.4sec 182.4sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
vendetta 4.3 0.0 120.3sec 120.3sec 27% 100%

Database details

  • id:
  • cooldown name:buff_vendetta
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.5%
poisoned 100.0%

Procs

Count Interval
combo_points 379.7 2.2sec
combo_points_wasted 17.5 24.5sec
deadly_poisons 346.6 1.3sec
ruthlessness 52.7 8.6sec
seal_fate 99.5 4.5sec
venomous_wounds 142.7 3.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.74%
σ of the average dps 5.9942
2 * σ / μ 0.0439%
95% Confidence Intervall ( μ ± 2σ ) ( 27266.07 - 27290.04 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27260.07 - 27296.04 )
Sample Data
σ 599.4161
Minimum 24776.98
Maximum 29504.60
Spread ( max - min ) 4727.62
Range ( max - min ) / 2 2363.81
Range% 8.67
10th Percentile 26535.07
90th Percentile 28077.68
( 90th Percentile - 10th Percentile ) 1542.62
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1931
0.1 scale factor error with delta=300 3193
0.05 scale factor error with delta=300 12775
0.01 scale factor error with delta=300 319377
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 garrote
A slice_and_dice,if=buff.slice_and_dice.down
B rupture,if=!ticking&time<6
C vendetta
D rupture,if=!ticking&buff.slice_and_dice.remains>6
E cold_blood,sync=envenom
F envenom,if=combo_points>=4&buff.envenom.down
G envenom,if=combo_points>=4&energy>90
H envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
I backstab,if=combo_points<5&target.health_pct<35
J mutilate,if=combo_points<4&target.health_pct>=35
K vanish,if=time>30&energy>50

Sample Sequence

01245689ACJBJEFJGJJGJGJGGJDDJJFJK9FGJGDJGJJFJGJFJDJFJFJDJFJFJDJFJFJJFDJFJJDJCJFJJJEFGJDDJFGJGJJFJDJFJFGJGJDJ8JFJFDJJFJDJJFK9JFJDJFJFJJFJDJCJFGJJDJJEFJJFJFDJFJJDJFJFJJFDJFJJDJFJFJFJDJFJJFJDI8IFCIIIFIIDIIIFIIEFIIDIIFK9IIFIIIIIFDDIIFIIGIIIIFIDIIIFIIDIIFIIIFIIDIIFIIFIIDIIFIIIFIIDCIIIFIIFIIGIIDIIIFIIIEFIIIF4IDIIFIIFIIIGIDIIIF8IIFI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 13.01% 13.01% 1333
Spell Crit 9.88% 4.88% 874
Spell Haste 16.59% 11.03% 1413
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 15656 11048 190
Melee Hit 11.10% 11.10% 1333
Melee Crit 29.90% 20.89% 874
Melee Haste 11.03% 11.03% 1413
Expertise 6.56 6.56 197
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.76% 17.76% 1749

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 3
Lethality 3
Ruthlessness 3
Quickening 2
Puncturing Wounds 3
Blackjack 0
Deadly Brew 1
Cold Blood 1
Vile Poisons 3
Deadened Nerves 0
Seal Fate 2
Murderous Intent 2
Overkill 1
Master Poisoner 1
Improved Expose Armor 0
Cut to the Chase 3
Venomous Wounds 2
Vendetta 1
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 2
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 3
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Assassination_T11_372
origin="http://chardev.org/?profile=36311"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
glyphs=expose_armor/mutilate/backstab/rupture
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/garrote
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/rupture,if=!ticking&time<6
actions+=/vendetta
actions+=/rupture,if=!ticking&buff.slice_and_dice.remains>6
actions+=/cold_blood,sync=envenom
actions+=/envenom,if=combo_points>=4&buff.envenom.down
actions+=/envenom,if=combo_points>=4&energy>90
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/backstab,if=combo_points<5&target.health_pct<35
actions+=/mutilate,if=combo_points<4&target.health_pct>=35
actions+=/vanish,if=time>30&energy>50
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=197
# gear_hit_rating=1333
# gear_crit_rating=874
# gear_haste_rating=1413
# gear_mastery_rating=1749
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Combat_T11_372 : 26794dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26794.4 11.48 / 0.04% 1009.0 26.6 26.4 energy 24.66% 45.7
Origin http://chardev.org/?profile=55921
Talents http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
Glyphs
  • expose_armor
  • slice_and_dice
  • sinister_strike
  • adrenaline_rush

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:56189|30150|23121|10564|8087|4555|3976&chds=0,112377&chco=C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++56189++killing_spree,C79C6E,0,0,15|t++30150++eviscerate,C79C6E,1,0,15|t++23121++rupture,C55D54,2,0,15|t++10564++sinister_strike,C79C6E,3,0,15|t++8087++revealing_strike,C79C6E,4,0,15|t++4555++melee_main_hand,C79C6E,5,0,15|t++3976++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Combat_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:19,17,15,14,9,8,8,4,3,2,1&chds=0,100&chco=C79C6E,C79C6E,C79C6E,336600,C79C6E,336600,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|melee_main_hand|melee_off_hand|instant_poison|main_gauche|deadly_poison|eviscerate|rupture|revealing_strike|killing_spree_mh|killing_spree_oh&chtt=Rogue_Combat_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:o82wrou0yvqoonlkjkklllqrppruy012467655664yspnlhfcaXWVUTTSTTTSTTTTTTUUUUUUUTTTUUUUUUUTTTTTTTTTTSSSSSSTTTTUUVVWXYZacdefghiijjkkkjjiihhgfedbaZZYXWVUUTTTSSSSSSSSSSSTSTTTTTTTTTTTTSSSSSSSTUUUUUVVWWVWWXXYZabbcdeffghiijjkkkkjjihgfedbaZYXWWVUUUTTTTTTTTTTTUUUUUUUUUUUTUTTTTTTTTSSSSSSSSTTTTUUVVWWXYZabbcdefgghhiiiiiihgggfeeddccbbaZZYXXWWVVUUUUTTTTTTTSSSSSSSSSSSSSSSSSSSSSSTUUVWWXYYZZZZaabccddeefgghijjklllllllkjihgfedcaZYYXWVVUUTTTTTSSSSSSSSSSSSSSSSSSSSSSSSSTSSTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=84&chtt=Rogue_Combat_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suvxyz01234556666787654210zyxwvuuuuuuutssrrrrqqponmlkkjihhgggffffffffgggghhhiiijjjjjkkkkjjjjiiihhggggfffffgghhijklmnoppqrssstssssrrqpponmllkjiihhggggggggghhhhiiiiiiiiiihhhhhgggggggggghhhijjklmmnnoopppppqqqqqqqpppppooonnnmmmmmllllkkkkjjjjiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiijjkkllmnnooppqqqqrrqqqqppoonnmmllkkjjjiiiiiiiiiiiiihhhhhhhhggggffffffgggghhhiijjkklmmnoooppqqqqqrrrrrrrrrrrqqqqqqppppooonnnmmllkkjjiiihhgggggffffffffffggggggghhhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26794|max=42308&chxp=1,1,63,100&chtt=Rogue_Combat_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,1,3,11,10,23,26,47,69,97,131,165,200,289,326,398,460,450,523,607,578,571,584,576,545,503,492,425,360,305,283,218,178,131,110,87,51,56,33,28,16,16,5,3,5,0,1,0,1&chds=0,607&chbh=5&chxt=x&chxl=0:|min=24809|avg=26794|max=29133&chxp=0,1,46,100&chtt=Rogue_Combat_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Combat_T11_372 26794
deadly_poison 2159 8.1% 187.5 2.40sec 5207 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148 6135 9481 13.4% 0.0% 98.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
187.53 2.80 148.35 148.35 0.0000 3.0000 976578
Direct Results Count Pct Average Min Max Total Damage
hit 2.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.5 86.60% 6134.54 989 9733 788136
crit 19.9 13.40% 9481.39 1528 15038 188443

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2127 7.9% 31.3 14.34sec 30726 30150 21290 43757 58658 42.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.31 31.31 0.00 0.00 1.0191 0.0000 962011
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 58.00% 21289.65 13135 28475 386607
crit 13.2 42.00% 43756.62 27058 58658 575404

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 3720 13.9% 484.7 0.99sec 3472 0 3248 5018 7747 13.4% 0.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.70 484.70 0.00 0.00 0.0000 0.0000 1682812
Direct Results Count Pct Average Min Max Total Damage
hit 418.1 86.25% 3248.42 2549 5014 1358080
crit 64.7 13.35% 5018.10 3938 7747 324732
miss 1.9 0.40% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
killing_spree 911 3.4% 7.3 63.54sec 56585 56189 0 0 0 0.0% 0.0% 0.0% 0.0% 36 0 0 0.0% 0.0% 4.0%

Stats details: killing_spree

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.28 7.28 36.30 0.00 1.0071 0.5000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:energy
  • tree:combat
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every .5 secs with both weapons until 5 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 576 2.1% 36.3 11.35sec 7177 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 5545 11477 27.5% 0.0% 0.0%

Stats details: killing_spree_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.30 0.00 0.00 36.30 0.0000 0.0000 260548
Tick Results Count Pct Average Min Max Total Damage
hit 26.3 72.48% 5545.13 3854 7367 145902
crit 10.0 27.52% 11477.31 7938 15176 114646

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 335 1.3% 36.3 11.35sec 4175 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3229 6678 27.4% 0.0% 0.0%

Stats details: killing_spree_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.30 0.00 0.00 36.30 0.0000 0.0000 151544
Tick Results Count Pct Average Min Max Total Damage
hit 26.3 72.59% 3229.30 2235 4327 85088
crit 10.0 27.41% 6677.75 4604 8913 66456

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 2474 9.2% 178.4 2.53sec 6272 0 4864 10041 15176 27.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.43 178.43 0.00 0.00 0.0000 0.0000 1119155
Direct Results Count Pct Average Min Max Total Damage
hit 129.9 72.80% 4864.35 3854 7367 631902
crit 48.5 27.20% 10040.74 7938 15176 487253

Action details: main_gauche

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 4550 17.0% 360.9 1.26sec 5704 4555 5133 10608 16163 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
360.91 360.91 0.00 0.00 1.2521 0.0000 2058464
Direct Results Count Pct Average Min Max Total Damage
hit 132.8 36.79% 5132.58 4088 7846 681565
crit 98.3 27.24% 10607.89 8422 16163 1042744
glance 86.7 24.02% 3854.70 3066 5885 334155
miss 43.1 11.95% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3975 14.8% 669.0 0.68sec 2687 3976 2419 4998 7617 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
669.04 669.04 0.00 0.00 0.6759 0.0000 1798031
Direct Results Count Pct Average Min Max Total Damage
hit 246.2 36.80% 2419.46 1927 3697 595687
crit 182.2 27.24% 4998.18 3969 7617 910732
glance 160.5 23.99% 1816.63 1445 2773 291612
miss 80.1 11.97% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revealing_strike 685 2.6% 37.5 11.96sec 8255 8087 6395 13214 16836 27.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: revealing_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.54 37.54 0.00 0.00 1.0207 0.0000 309861
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 72.73% 6395.01 5110 8173 174593
crit 10.2 27.27% 13213.86 10527 16836 135268

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reveals a weakness, increasing the effectiveness of the rogue's next finishing move by $s3%.
  • description:An instant strike that causes $m1% of your normal weapon damage and increases the effectiveness of your next offensive finishing move on that target by $s3% for $d. Awards 1 combo point.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 999 3.7% 19.2 23.30sec 23575 23121 0 0 0 0.0% 0.0% 0.0% 0.0% 153 2294 4743 27.1% 0.0% 67.6%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.17 19.17 152.83 152.83 1.0196 2.0000 451912
Direct Results Count Pct Average Min Max Total Damage
hit 19.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 111.5 72.94% 2294.36 1464 3178 255762
crit 41.4 27.06% 4743.22 3015 6546 196150

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
sinister_strike 5195 19.4% 218.8 2.07sec 10740 10564 7434 17709 22617 32.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
218.79 218.79 0.00 0.00 1.0167 0.0000 2349887
Direct Results Count Pct Average Min Max Total Damage
hit 148.4 67.82% 7434.21 6012 9511 1103123
crit 70.4 32.18% 17708.66 14296 22617 1246764

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:39.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:200.29
  • base_dd_max:200.29
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slice_and_dice 0 0.0% 16.1 28.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.15 16.15 0.00 0.00 1.0187 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.1 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Combat_T11_372
eviscerate energy 9.1% 877.9 35
revealing_strike energy 12.5% 206.4 40
rupture energy 4.0% 943.0 25
sinister_strike energy 71.0% 275.4 39
slice_and_dice energy 3.4% 0.0 25
Resource Gains Type Count energy Average Overflow
adrenaline_rush energy 417.3 1456.3 3.5 6.9%
combat_potency energy 153.6 2240.7 14.6 2.7%
energy_regen energy 1809.6 6767.5 3.7 1.5%
relentless_strikes energy 59.3 1481.3 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.3 0.0 88.4sec 88.4sec 23% 34%

Database details

  • id:
  • cooldown name:buff_adrenaline_rush
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
berserking 3.0 0.0 180.4sec 180.4sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 173.1 0.0 2.6sec 2.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
killing_spree 7.3 0.0 63.5sec 63.5sec 3% 39%

Database details

  • id:
  • cooldown name:buff_killing_spree
  • tooltip:(null)
  • max_stacks:1
  • duration:2.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 13.4 13.7 33.7sec 16.2sec 51% 53%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.6 4.1 45.2sec 30.9sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
poison_doses 2.8 184.0 144.3sec 2.4sec 99% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.4sec 78.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
revealing_strike 37.5 0.0 12.0sec 12.0sec 15% 85%

Database details

  • id:
  • cooldown name:buff_revealing_strike
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
slice_and_dice 1.4 14.8 216.0sec 28.8sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:40.50
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 7.8 1.3 52.6sec 44.6sec 14% 20%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
deep_insight 41.2%
energy_cap 1.9%
moderate_insight 20.1%
shallow_insight 20.5%

Procs

Count Interval
combo_points 300.1 1.8sec
combo_points_wasted 1.3 118.1sec
deadly_poisons 187.5 2.4sec
main_gauche 178.4 2.5sec
sinister_strike_glyph 43.8 10.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.16%
σ of the average dps 5.7412
2 * σ / μ 0.0429%
95% Confidence Intervall ( μ ± 2σ ) ( 26782.89 - 26805.85 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26777.15 - 26811.59 )
Sample Data
σ 574.1244
Minimum 24808.69
Maximum 29133.26
Spread ( max - min ) 4324.57
Range ( max - min ) / 2 2162.29
Range% 8.07
10th Percentile 26086.64
90th Percentile 27555.62
( 90th Percentile - 10th Percentile ) 1468.98
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1836
0.1 scale factor error with delta=300 2929
0.05 scale factor error with delta=300 11719
0.01 scale factor error with delta=300 292994
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 kick
7 berserking
8 slice_and_dice,if=buff.slice_and_dice.down
9 slice_and_dice,if=buff.slice_and_dice.remains<2
A killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
B adrenaline_rush,if=energy<35
C eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
D rupture,if=!ticking&combo_points=5&target.time_to_die>10
E eviscerate,if=combo_points=5
F revealing_strike,if=combo_points=4&buff.revealing_strike.down
G sinister_strike,if=combo_points<5

Sample Sequence

012457G8GGGDGGGGFAEGGGFCGGB9GGFCGGGGFDGGGFEGGGGFEGGG9GGGFDGGAGGFEGGGGDG9GGGGFCGGGGDGG9GGGEGBGGGDGGGEGGGFCGGGGFCGG9GAGGDGGGGEGGGGDG9GGGGFCGGGFDG79GGGGEGGFEGGAGBGFDGGGFCG9GGFEGGGGFDGGGGFEG9GGGGDGGGGFEG9GGAGGGDGGGG9GGGFCGGGGBDGGGGEGGGGFEGGG9GGGGCGGGAGFDGGGGEGGGGDGGG9GGGGFDGGGG7EGGGGDGBG9GGGGFCGGGGFCGGGCGGGGFDGG9GGGAGEGGGGGCGGG9GGGFDGGGGFEGGGFDGGGBG9GGGFCGGGDGGGGEGGGGFCGGGCGGAGFDGGGG9GGGGDGG4GFEGGGFDGGGGF79GG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 10.60% 10.60% 1086
Spell Crit 10.24% 5.24% 940
Spell Haste 18.83% 13.17% 1687
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20352 14362 190
Melee Hit 9.04% 9.04% 1086
Melee Crit 30.27% 21.26% 940
Melee Haste 13.17% 13.17% 1687
Expertise 26.01 26.01 781
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1057

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 2
Puncturing Wounds 0
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 2
Improved Sinister Strike 3
Precision 3
Improved Slice and Dice 2
Improved Sprint 2
Aggression 3
Improved Kick 0
Lightning Reflexes 3
Revealing Strike 1
Reinforced Leather 0
Improved Gouge 0
Combat Potency 3
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 1
Savage Combat 2
Bandit's Guile 3
Restless Blades 2
Killing Spree 1
Subtlety Rank
Nightstalker 0
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 0
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Combat_T11_372
origin="http://chardev.org/?profile=55921"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
glyphs=expose_armor/slice_and_dice/sinister_strike/adrenaline_rush
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/kick
actions+=/berserking
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
actions+=/rupture,if=!ticking&combo_points=5&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5
actions+=/revealing_strike,if=combo_points=4&buff.revealing_strike.down
actions+=/sinister_strike,if=combo_points<5
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=1086
# gear_crit_rating=940
# gear_haste_rating=1687
# gear_mastery_rating=1057
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Subtlety_T11_372 : 26677dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26677.5 9.46 / 0.04% 1202.0 22.2 22.1 energy 34.48% 46.2
Origin http://chardev.org/?profile=36352
Talents http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
Glyphs
  • expose_armor
  • backstab
  • shadow_dance
  • slice_and_dice

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:116416|34062|26121|25204|4693|2346&chds=0,232833&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++116416++rupture,C55D54,0,0,15|t++34062++ambush,C79C6E,1,0,15|t++26121++eviscerate,C79C6E,2,0,15|t++25204++backstab,C79C6E,3,0,15|t++4693++melee_main_hand,C79C6E,4,0,15|t++2346++melee_off_hand,C79C6E,5,0,15&chtt=Rogue_Subtlety_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:31,18,11,11,9,8,7,5&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,C55D54&chl=backstab|melee_main_hand|ambush|eviscerate|melee_off_hand|instant_poison|deadly_poison|rupture&chtt=Rogue_Subtlety_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:k70mtmYdWUUcifnoroejadbfbgrtqzzrlekhgfhptjYdZYZXbfeXdXbmkbcfXefmuuqjcZZSSWbXdaahkfcgagedccfhfZdacggbbeZdacaeehdadadeeZdcbdccbhkrusngZWTSVWYZbbcfdebcbdcdcacbccebefeecddgdgeeffedebededfefgehinqsqnicZWVWYYaabccdcecdccddddededdddddededdcdccccdcedeeffefefgjloppmieaXWXXZZbcdddededdcccbcbcbdcdccccdcdcdcddcdcdcdccccccdeghknoonkhdaYYYYabcddeddcdccccdcdcdcdcdccdcdcdcdddeeffffgghhggghijkmmljgdaYXXXYZabcddeeeeeeeeeeefeeeeeeeddddcdddccdcccccdddccddfgikmmljgdbZY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=86&chtt=Rogue_Subtlety_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:75653445543231zzwvvuutttstrqooooooqpqqqqqommkkjjiiiigffdeefeffggghiihiiiiijjkjihhghgggffffffeffeeddddccbcccccccdddccbbccdeffggggghhhhhhijjjjjihggffffeeeddddccccccccccccdddeeeeeeffeeeffgghhiiiiiiiiiiijjjjjihhggfffffffffffffffffgggggggfffffeeeeeddeeffghhhiiiiiiiijjjjjjihggfeeedddcccccccccbbbbbbbcccccccccccccccdeefghhhiiiijjkkklllkkjiihggfffeedddcccccccccddddeeefffggghhhiiijjjkkkkkklllllllllkkkjjiiiiiiiiiiiiiiiiiiiiiiihhhgggfffeeddddddeeffgghhhhhiijkk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26677|max=47473&chxp=1,1,56,100&chtt=Rogue_Subtlety_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,1,2,5,10,22,21,39,52,84,123,136,190,259,274,367,403,497,516,554,587,640,607,595,575,547,504,424,404,325,276,221,172,151,113,92,65,38,36,25,19,10,4,4,4,0,1,1,1&chds=0,640&chbh=5&chxt=x&chxl=0:|min=24989|avg=26677|max=28630&chxp=0,1,46,100&chtt=Rogue_Subtlety_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Subtlety_T11_372 26677
ambush 3012 11.3% 39.2 11.35sec 34798 34062 16723 35623 57105 95.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.15 39.15 0.00 0.00 1.0216 0.0000 1362470
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 4.26% 16723.49 14352 24967 27920
crit 37.5 95.68% 35622.76 26877 57105 1334550
dodge 0.0 0.05% 0.00 0 0 0

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target (${$m2*1.447}% plus ${$m1*$m2/100*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:367.95
  • base_dd_max:367.95
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
backstab 8190 30.7% 142.9 3.08sec 25931 25204 13170 31426 46055 69.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.89 142.89 0.00 0.00 1.0289 0.0000 3705268
Direct Results Count Pct Average Min Max Total Damage
hit 42.9 30.01% 13169.91 11839 19367 564647
crit 99.9 69.94% 31426.13 28152 46055 3140621
dodge 0.1 0.05% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
deadly_poison 1928 7.2% 167.2 2.70sec 5218 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147 5488 8482 14.6% 0.0% 97.6%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.19 3.84 147.25 147.25 0.0000 3.0000 872429
Direct Results Count Pct Average Min Max Total Damage
hit 3.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.8 85.40% 5487.73 1079 7345 690120
crit 21.5 14.60% 8482.26 1667 11348 182309

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2950 11.1% 49.8 8.92sec 26800 26121 18041 37160 52612 45.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
49.80 49.80 0.00 0.00 1.0260 0.0000 1334685
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 54.08% 18041.06 15278 25540 485889
crit 22.8 45.87% 37159.76 31472 52612 848796
dodge 0.0 0.06% 0.00 0 0 0

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 2127 8.0% 315.0 1.43sec 3054 0 2935 4535 5846 14.1% 3.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
315.00 315.00 0.00 0.00 0.0000 0.0000 962075
Direct Results Count Pct Average Min Max Total Damage
hit 259.3 82.32% 2934.85 2781 3784 761023
crit 44.3 14.07% 4535.18 4296 5846 201053
miss 11.4 3.61% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4689 17.6% 510.3 0.89sec 4157 4693 3555 7385 10605 35.2% 15.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
510.29 510.29 0.00 0.00 0.8859 0.0000 2121474
Direct Results Count Pct Average Min Max Total Damage
hit 131.4 25.74% 3555.23 3091 5148 466985
crit 179.6 35.20% 7385.22 6368 10605 1326587
glance 122.4 23.99% 2679.05 2319 3861 327901
dodge 0.3 0.06% 0.00 0 0 0
miss 76.6 15.02% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2344 8.8% 655.6 0.69sec 1618 2346 1383 2873 4125 35.2% 15.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
655.59 655.59 0.00 0.00 0.6897 0.0000 1060574
Direct Results Count Pct Average Min Max Total Damage
hit 168.6 25.72% 1382.69 1203 2003 233162
crit 230.9 35.22% 2872.64 2477 4125 663314
glance 157.5 24.02% 1042.17 902 1502 164098
dodge 0.4 0.06% 0.00 0 0 0
miss 98.2 14.98% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recuperate 0 0.0% 14.9 30.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recuperate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.88 14.88 0.00 0.00 1.0191 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: recuperate

Static Values
  • id:73651
  • school:physical
  • resource:energy
  • tree:combat
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Recovering $w1% of maximum health every $t1 sec.
  • description:Finishing move that consumes combo points on any nearby target to restore $s1% of maximum health every $t1 sec. Lasts longer per combo point: 1 point : 6 seconds 2 points: 12 seconds 3 points: 18 seconds 4 points: 24 seconds 5 points: 30 seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rupture 1437 5.4% 5.5 87.68sec 118518 116416 0 0 0 0.0% 0.1% 0.0% 0.0% 220 2155 4453 35.1% 0.0% 97.1%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.49 5.49 219.56 219.56 1.0181 2.0000 650178
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 99.95% 0.00 0 0 0
dodge 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 142.5 64.92% 2155.48 2058 2750 307243
crit 77.0 35.08% 4452.85 4238 5665 342935

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 17.3 26.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.32 17.32 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 17.3 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Subtlety_T11_372
ambush energy 15.6% 869.9 40
backstab energy 56.9% 648.3 40
eviscerate energy 17.4% 765.7 35
recuperate energy 4.4% 0.0 30
rupture energy 1.4% 4740.7 25
slice_and_dice energy 4.3% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 99.9 499.7 5.0 0.0%
energy_refund energy 175.6 4.0 0.0 0.0%
energy_regen energy 1809.6 5574.0 3.1 0.0%
recuperate energy 143.2 1718.2 12.0 0.0%
relentless_strikes energy 87.4 2186.2 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 142.6 0.0 3.1sec 3.1sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
find_weakness 11.7 27.4 40.0sec 11.4sec 37% 100%

Database details

  • id:
  • cooldown name:buff_find_weakness
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.0 8.1 37.2sec 21.6sec 41% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.7 46.4sec 32.3sec 29% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.7 0.0 83.3sec 83.3sec 7% 100%

Database details

  • id:
  • cooldown name:buff_master_of_subtlety
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 3.8 157.3 112.2sec 2.8sec 98% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.8sec 78.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
recuperate 6.7 8.2 70.0sec 31.0sec 95% 95%

Database details

  • id:
  • cooldown name:buff_recuperate
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_dance 7.6 0.0 63.2sec 63.2sec 13% 13%

Database details

  • id:
  • cooldown name:buff_shadow_dance
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
shadowstep 7.6 0.0 63.5sec 63.5sec 0% 100%

Database details

  • id:
  • cooldown name:buff_shadowstep
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 8.6 8.7 53.4sec 26.8sec 97% 99%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.8 1.1 47.0sec 41.4sec 11% 17%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 4.7 0.0 98.6sec 98.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points 486.3 1.2sec
combo_points_wasted 46.5 13.7sec
deadly_poisons 167.2 2.7sec
hat_donor 303.1 1.5sec
honor_among_thieves 205.3 2.2sec
serrated_blades 49.8 8.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.82%
σ of the average dps 4.7285
2 * σ / μ 0.0354%
95% Confidence Intervall ( μ ± 2σ ) ( 26667.99 - 26686.91 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26663.26 - 26691.64 )
Sample Data
σ 472.8512
Minimum 24988.74
Maximum 28630.28
Spread ( max - min ) 3641.54
Range ( max - min ) / 2 1820.77
Range% 6.83
10th Percentile 26093.05
90th Percentile 27307.69
( 90th Percentile - 10th Percentile ) 1214.64
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1256
0.1 scale factor error with delta=300 1987
0.05 scale factor error with delta=300 7949
0.01 scale factor error with delta=300 198745
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 pool_energy,for_next=1
A shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
B pool_energy,for_next=1
C vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
D shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
E premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
F ambush,if=combo_points<=4
G preparation,if=cooldown.vanish.remains>60
H slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
I rupture,if=combo_points=5&!ticking
J recuperate,if=combo_points=5&remains<3
K eviscerate,if=combo_points=5&dot.rupture.remains>1
L backstab,if=combo_points<3&energy>60
M backstab,if=cooldown.honor_among_thieves.remains>1.75
N backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0

Sample Sequence

0124568DEFHAFFIFFJFFKLMKLLMKMMHCEFGKLLMJLLKCFMKMMKLLHLMMK9999ADEFJFFKFKLLHLLMKLLKLLMJLMKLMMHLMKMMKLL999JADEFKFFHFKLMMKLMKMMJLMMHMMILMMKLMKL8LKLL9999ADFHEFJFKFKLLKLLMKMMHCEFJLLILLMKMMKLLHLLMK999ADEFJFFKFKMMKLMHLLMKMMJLMKLLHLLMKLLKLM999999JADEFKFFKFHLMMKLMKLLKLLHLMMJMM8ILLKCEFGKLLMH9999ADFKFFJFKMMKLMMHLMKCEFKLLJLLMKMMHLMMKLMKM9999999ADFJEFKFFHLMKMMKLLKLMMHLMJMMILMMKMMKLM99H999ADEFKFFJFK4MLKLMMKLMHLMJL8MMIM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 8637 6944 4879
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.38% 9.38% 961
Spell Crit 11.43% 6.43% 1152
Spell Haste 20.59% 14.84% 1901
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20143 14341 190
Melee Hit 8.00% 8.00% 961
Melee Crit 37.73% 27.51% 1152
Melee Haste 14.84% 14.84% 1901
Expertise 25.78 25.78 774
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 29.69% 23.83% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.50% 11.50% 628

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 0
Puncturing Wounds 3
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 0
Improved Ambush 3
Relentless Strikes 3
Elusiveness 1
Waylay 0
Opportunity 3
Initiative 2
Energetic Recovery 3
Find Weakness 2
Hemorrhage 1
Honor Among Thieves 3
Premeditation 1
Enveloping Shadows 0
Cheat Death 0
Preparation 1
Sanguinary Vein 2
Slaughter from the Shadows 3
Serrated Blades 2
Shadow Dance 1

Profile

#!./simc

rogue=Rogue_Subtlety_T11_372
origin="http://chardev.org/?profile=36352"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
glyphs=expose_armor/backstab/shadow_dance/slice_and_dice
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/pool_energy,for_next=1
actions+=/shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
actions+=/pool_energy,for_next=1
actions+=/vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
actions+=/shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=4
actions+=/preparation,if=cooldown.vanish.remains>60
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&!ticking
actions+=/recuperate,if=combo_points=5&remains<3
actions+=/eviscerate,if=combo_points=5&dot.rupture.remains>1
actions+=/backstab,if=combo_points<3&energy>60
actions+=/backstab,if=cooldown.honor_among_thieves.remains>1.75
actions+=/backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4879
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=774
# gear_hit_rating=961
# gear_crit_rating=1152
# gear_haste_rating=1901
# gear_mastery_rating=628
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# These values represent the avg HAT donor interval of the raid. # A negative value will make the Rogue use a programmed default interval. # A zero value will disable virtual HAT procs and assume a real raid is being simulated. virtual_hat_interval=-1 # A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Shaman_Elemental_T11_372 : 26666dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26666.3 11.80 / 0.04% 22.0 1211.5 1225.4 mana 0.00% 47.0
Origin http://chardev.org/?profile=14385
Talents http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
Glyphs
  • chain_lightning
  • thunder
  • healing_stream_totem
  • thunderstorm
  • astral_recall
  • renewed_life
  • flame_shock
  • lightning_bolt
  • lava_burst

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:39839|31173|13587|7501|5098|3566|625|126&chds=0,79678&chco=C41F3B,C41F3B,336600,336600,C41F3B,C41F3B,C79C6E,C41F3B&chm=t++39839++flame_shock,C41F3B,0,0,15|t++31173++lava_burst,C41F3B,1,0,15|t++13587++lightning_bolt,336600,2,0,15|t++7501++earth_shock,336600,3,0,15|t++5098++fire_nova,C41F3B,4,0,15|t++3566++fire_melee,C41F3B,5,0,15|t++625++earth_melee,C79C6E,6,0,15|t++126++fire_shield,C41F3B,7,0,15&chtt=Shaman_Elemental_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x340&cht=p&chf=bg,s,333333&chd=t:35,19,10,9,7,7,6,2,2,1,1,0,0,0&chds=0,100&chco=336600,C41F3B,336600,336600,C41F3B,C41F3B,C41F3B,336600,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C41F3B&chl=lightning_bolt|lava_burst|lightning_bolt_overload|fulmination|flame_shock|searing_totem|lava_burst_overload|earth_shock|fire_melee|fire_nova|earth_melee|fire_blast|darkmoon_card_volcano|fire_shield&chtt=Shaman_Elemental_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:q32zyyyyz01223344556545544444444444455555555555555555566667777666666655555555554444555555555555556666677777776666666655555555554444444444555555566667777877777766666555555555555555555444444445555666677777776666655555555555555555555555555556666666666666666666665555555555555555555555555566666666666666666666665555555555555555555555556666666666666666666666666665555555544444445555556666666777766666666555555555555555555555555555555555555666666666555555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=117014&chtt=Shaman_Elemental_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwy1122223464577765421zywuutssrqqqppppqponmnmmmmnmmllmllmllmmnnoononnnnnopoopppponnonnonoonnnnmmmmmmllmmlmmmmlkkkkjjjihhhhhgggfffffffgghijklmnoppqqqrrrrrrrrqpoonmllkkjjiihhhgggffggghhiiiiiijjjkkkkllkkjjiiihhhhhhiiiijjkklmmnnnooooooooonnmmlllkkkkjjjjjiihhhhhhhhggggggfffgggggghhhhhhiiijjkklllmmnnnnnnnnnnnmmlkkjjiihhhhhhggghhhhiiiiijjjjjjjjjjjjiiiiiiiiiiiihhhhiiijjkkllmnnoppqqrrrrrrqqppoonmllkjjihhhggggggggggggggfffffffffffgggghhhhiiijjkkklllllllllmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26666|max=42502&chxp=1,1,63,100&chtt=Shaman_Elemental_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,6,3,8,10,20,46,44,63,119,135,179,212,284,331,402,434,459,502,609,610,598,572,546,558,483,441,420,358,313,266,201,164,154,100,99,60,48,41,30,17,15,17,7,5,3,3,3&chds=0,610&chbh=5&chxt=x&chxl=0:|min=24594|avg=26666|max=28936&chxp=0,1,48,100&chtt=Shaman_Elemental_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Elemental_T11_372 26666
darkmoon_card_volcano 70 0.3% 10.1 47.04sec 3133 0 2723 4211 4516 27.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.08 10.08 0.00 0.00 0.0000 0.0000 31586
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.43% 2723.00 2694 2923 19882
crit 2.8 27.57% 4210.52 4162 4516 11704

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
earth_shock 598 2.2% 30.4 14.58sec 8881 7501 6931 14570 20686 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.43 30.43 0.00 0.00 1.1839 0.0000 270227
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.48% 6931.10 5948 9898 157070
crit 7.8 25.52% 14570.13 12432 20686 113157

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
elemental_mastery 0 0.0% 6.6 74.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_mastery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.63 6.63 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.6 100.00% 0.00 0 0 0

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:mana
  • tree:elemental
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Cast time of your next Lightning Bolt, Chain Lightning or Lava Burst spell is reduced by $s1%.
  • description:When activated, your next Lightning Bolt, Chain Lightning or Lava Burst spell becomes an instant cast spell. In addition, your Fire, Frost, and Nature damage is increased by $64701s2%$?s55452[, you take $55452s1% less damage from all sources,][] and you gain $64701s1% spell haste for $64701d.
flame_shock 1835 6.9% 17.7 26.23sec 46768 39839 3854 8087 10516 35.4% 0.0% 0.0% 0.0% 202 2613 5486 35.6% 0.0% 99.6%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.74 17.74 202.17 202.17 1.1739 2.2279 829729
Direct Results Count Pct Average Min Max Total Damage
hit 11.5 64.62% 3854.11 3316 5031 44185
crit 6.3 35.38% 8086.93 6930 10516 50761
Tick Results Count Pct Average Min Max Total Damage
hit 130.3 64.45% 2613.24 2226 3429 340476
crit 71.9 35.55% 5485.83 4653 7167 394306

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:9
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 2369 8.9% 30.4 14.58sec 35214 0 27482 57791 87855 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.43 30.43 0.00 0.00 0.0000 0.0000 1071490
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.49% 27481.67 16522 42036 622886
crit 7.8 25.51% 57791.14 34530 87855 448604

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
lava_burst 5104 19.1% 61.5 7.39sec 37528 31173 0 37627 54380 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.51 61.34 0.00 0.00 1.2038 0.0000 2308136
Direct Results Count Pct Average Min Max Total Damage
crit 61.3 100.00% 37626.96 32364 54380 2308136

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.828000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_burst_overload 1514 5.7% 25.3 17.58sec 27063 0 12274 27175 37607 99.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.30 25.23 0.00 0.00 0.0000 0.0000 684565
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 0.24% 12273.88 11086 15411 756
crit 25.2 99.76% 27174.64 22381 37607 683809

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.622000
  • base_dd_min:1047.17
  • base_dd_max:1335.47
lightning_bolt 9409 35.3% 219.9 2.04sec 19346 13587 15127 31882 46051 25.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
219.94 219.22 0.00 0.00 1.4239 0.0000 4254924
Direct Results Count Pct Average Min Max Total Damage
hit 163.2 74.44% 15127.07 12808 22034 2468462
crit 56.0 25.56% 31882.09 26769 46051 1786462

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.914000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_bolt_overload 2788 10.5% 90.3 4.93sec 13953 0 10916 22987 33307 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.34 90.05 0.00 0.00 0.0000 0.0000 1260614
Direct Results Count Pct Average Min Max Total Damage
hit 67.0 74.46% 10916.07 9264 15936 731886
crit 23.0 25.54% 22987.06 19361 33307 528728

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.686000
  • base_dd_min:539.17
  • base_dd_max:615.99
searing_totem 1821 6.8% 6.0 60.34sec 138381 137617 0 0 0 0.0% 0.0% 0.0% 0.0% 202 3189 6704 25.4% 0.0% 71.3%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.95 5.95 201.66 201.66 1.0056 1.6000 823492
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 150.4 74.56% 3189.45 2741 4281 479547
crit 51.3 25.44% 6703.98 5729 8947 343945

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - fire_elemental 3699
fire_blast 433 11.7% 12.0 9.86sec 4410 0 4278 8554 9333 3.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 52917
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.91% 4277.82 3822 4667 49750
crit 0.4 3.09% 8553.63 7645 9333 3167

Action details: fire_blast

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:302.1
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:276.00
  • base_dd_max:321.00
fire_melee 2137 57.8% 23.0 4.93sec 11346 3566 11999 42010 45890 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 3.1818 0.0000 260948
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 75.77% 11998.89 10699 13111 209114
crit 0.1 0.22% 42010.28 37447 45890 2130
glance 5.5 24.01% 9001.85 8024 9834 49704

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.135000
  • base_dd_min:427.00
  • base_dd_max:460.00
fire_nova 1002 27.1% 12.0 9.86sec 10197 5098 9897 19856 21608 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 2.0000 0.0000 122363
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.98% 9896.62 8836 10804 115179
crit 0.4 3.02% 19855.62 17672 21608 7184

Action details: fire_nova

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:233.8
  • cooldown:7.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:583.00
  • base_dd_max:663.00
fire_shield 127 3.4% 40.9 3.00sec 378 126 367 734 830 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.92 40.92 0.00 0.00 3.0000 0.0000 15465
Direct Results Count Pct Average Min Max Total Damage
hit 39.7 97.00% 366.92 0 415 14564
crit 1.2 3.00% 734.42 0 830 900

Action details: fire_shield

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.032000
  • base_dd_min:89.00
  • base_dd_max:89.00
pet - earth_elemental 587
earth_melee 587 100.0% 58.0 2.00sec 1250 625 1288 2578 2660 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 2.0000 0.0000 72497
Direct Results Count Pct Average Min Max Total Damage
hit 42.3 72.97% 1288.48 1144 1330 54529
crit 1.7 3.01% 2578.37 2288 2660 4505
glance 13.9 24.02% 966.33 858 997 13463

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Elemental_T11_372
earth_elemental_totem mana 1.0% 0.0 5623
earth_shock mana 16.8% 2.9 3019
fire_elemental_totem mana 1.0% 0.0 5388
flame_shock mana 9.7% 15.6 2994
lava_burst mana 20.4% 20.7 1817
lightning_bolt mana 40.5% 19.2 1010
searing_totem mana 1.3% 118.2 1171
pet - fire_elemental
fire_blast mana 56.4% 14.6 302
fire_nova mana 43.6% 43.8 233
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 26918.7 14.9 8.8%
flask mana 1.0 5700.0 5700.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 106835.0 106835.0 0.0%
mp5_regen mana 1809.6 96933.6 53.6 8.5%
replenishment mana 1809.6 51122.1 28.2 8.1%
rolling_thunder mana 185.5 372129.1 2005.7 18.5%
pet - fire_elemental mana
initial_mana none 1.0 47510.9 47510.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
elemental_focus 85.3 54.2 5.3sec 3.2sec 68% 68%

Database details

  • id:16246
  • cooldown name:buff_elemental_focus
  • tooltip:Your next $n damage or healing spells have their mana cost reduced by $s1%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 6.6 0.0 74.1sec 74.1sec 22% 24%

Database details

  • id:64701
  • cooldown name:buff_elemental_mastery
  • tooltip:Fire, Frost, and Nature damage increased by $s2%. Casting speed of all spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.6sec 48.6sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 113.1sec 113.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 1.0 0.0 338.7sec 338.7sec 4% 4%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
fire_elemental-casting 1.0 51.9 0.0sec 2.3sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:9
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
fulmination_4 2.9 97.4sec
fulmination_5 2.6 101.0sec
fulmination_6 24.9 17.8sec
lava_surge 40.4 11.0sec
rolling_thunder 185.5 2.4sec
wasted_lightning_shield 8.7 44.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.25%
σ of the average dps 5.9023
2 * σ / μ 0.0443%
95% Confidence Intervall ( μ ± 2σ ) ( 26654.50 - 26678.11 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26648.60 - 26684.01 )
Sample Data
σ 590.2338
Minimum 24593.67
Maximum 28936.46
Spread ( max - min ) 4342.79
Range ( max - min ) / 2 2171.39
Range% 8.14
10th Percentile 25941.75
90th Percentile 27451.17
( 90th Percentile - 10th Percentile ) 1509.43
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1959
0.1 scale factor error with delta=300 3096
0.05 scale factor error with delta=300 12386
0.01 scale factor error with delta=300 309667
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 flametongue_weapon,weapon=main
3 lightning_shield
4 mana_spring_totem
5 wrath_of_air_totem
6 snapshot_stats
7 volcanic_potion,if=!in_combat|buff.bloodlust.react
8 wind_shear
9 bloodlust,health_percentage<=25
A bloodlust,if=target.time_to_die<=60
B berserking
C elemental_mastery
D unleash_elements,moving=1
E flame_shock,if=!ticking|ticks_remain<3
F lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
G earth_shock,if=buff.lightning_shield.stack=9
H earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
I fire_elemental_totem
J earth_elemental_totem
K searing_totem
L spiritwalkers_grace,moving=1
M chain_lightning,if=target.adds>2
N lightning_bolt
O thunderstorm

Sample Sequence

01237ABCEFIFJNNNNNNFFNNFGNNFNNNENNNFNGFNNFNNNNNGFNNNENNFNNNNNGFNNNCNNHFNNNENNNFNGNNNFNGNNNNEFNNNNGFNFNNNNKNFHFNNENNNFNGNNNCNFNFNGNNNNEFNNNGNFNNNNNNFGBFKNNENNNFGNNFNNNNNNFHNNNENFNGNCNNNFNNNNNNFHNNNEKNFGNNNNNFNNNNHNFNENNNNFGNNNNNFNNHNNCFENNNNKFGFNNNNNNFNHNFNENNFNNNNNGFNNNNHNFNENNNGFNNBKNFNNNNCNNHFNNNENNNFGNNNFNNNNNHFNNEFNNNNFNNGNNFKNNNENFNNGNFNNNCNNGFNNNENNNFGFNFNNFNNNNNGFNNEKNFNNNNNNFGNNNNNEFNNNNGNFNCNNFNNNGNNNFENNNNNBFKNNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 736 152 20
Agility 683 102 20
Stamina 7631 6009 5861
Intellect 6097 5314 4926
Spirit 983 983 826
Health 143601 120963 0
Mana 113885 102860 0
Spell Power 10276 7511 2207
Spell Hit 17.03% 17.03% 919
Spell Crit 21.32% 15.11% 309
Spell Haste 19.90% 14.19% 1817
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 2436 466 0
Melee Hit 7.65% 7.65% 919
Melee Crit 14.75% 7.96% 309
Melee Haste 14.19% 14.19% 1817
Expertise 0.00 0.00 0
Armor 19472 15396 15396
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.92% 2.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 18.23% 18.23% 1834

Gear

Encoded
head headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
tabard empty

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 3
Call of Flame 2
Elemental Warding 0
Reverberation 2
Elemental Precision 3
Rolling Thunder 2
Elemental Focus 1
Elemental Reach 2
Elemental Oath 2
Lava Flows 3
Fulmination 1
Elemental Mastery 1
Earth's Grasp 0
Totemic Wrath 1
Feedback 3
Lava Surge 2
Earthquake 1
Enhancement Rank
Elemental Weapons 2
Focused Strikes 0
Improved Shields 3
Elemental Devastation 0
Flurry 0
Ancestral Swiftness 2
Totemic Reach 2
Toughness 0
Stormstrike 0
Static Shock 0
Frozen Power 0
Improved Fire Nova 0
Searing Flames 0
Earthen Power 0
Shamanistic Rage 0
Unleashed Rage 0
Maelstrom Weapon 0
Improved Lava Lash 0
Feral Spirit 0
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Elemental_T11_372
origin="http://chardev.org/?profile=14385"
level=85
race=troll
role=spell
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
glyphs=chain_lightning/thunder/healing_stream_totem/thunderstorm/astral_recall/renewed_life/flame_shock/lightning_bolt/lava_burst
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/flametongue_weapon,weapon=main
actions+=/lightning_shield
actions+=/mana_spring_totem
actions+=/wrath_of_air_totem
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat|buff.bloodlust.react
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/berserking
actions+=/elemental_mastery
actions+=/unleash_elements,moving=1
actions+=/flame_shock,if=!ticking|ticks_remain<3
actions+=/lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
actions+=/earth_shock,if=buff.lightning_shield.stack=9
actions+=/earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains actions+=/fire_elemental_totem
actions+=/earth_elemental_totem
actions+=/searing_totem
actions+=/spiritwalkers_grace,moving=1
actions+=/chain_lightning,if=target.adds>2
actions+=/lightning_bolt
actions+=/thunderstorm
head=headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders=shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
chest=circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist=lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs=kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet=boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists=chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands=gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5861
# gear_intellect=4926
# gear_spirit=826
# gear_spell_power=2207
# gear_hit_rating=919
# gear_crit_rating=309
# gear_haste_rating=1817
# gear_mastery_rating=1834
# gear_armor=15396
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Shaman_Enh_T11_372 : 26683dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26683.4 10.81 / 0.04% 35.4 753.7 752.1 mana 18.54% 36.8
Origin http://chardev.org/?profile=39863
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:23673|19442|14766|9851|8473|3261|2958|1475|653&chds=0,47346&chco=C41F3B,C41F3B,336600,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23673++lava_lash,C41F3B,0,0,15|t++19442++flame_shock,C41F3B,1,0,15|t++14766++lightning_bolt,336600,2,0,15|t++9851++stormstrike,C79C6E,3,0,15|t++8473++earth_shock,336600,4,0,15|t++3261++wolf_melee,C79C6E,5,0,15|t++2958++melee_main_hand,C79C6E,6,0,15|t++1475++melee_off_hand,C79C6E,7,0,15|t++653++earth_melee,C79C6E,8,0,15&chtt=Shaman_Enh_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:13,11,11,10,10,8,5,5,4,4,4,3,3,3,2,2,1,1&chds=0,100&chco=C41F3B,336600,C79C6E,C79C6E,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,336600,336600,C79C6E,C41F3B,C41F3B,336600,C79C6E,C79C6E,C79C6E&chl=lava_lash|lightning_bolt|melee_main_hand|windfury_mh|searing_totem|flametongue_oh|melee_off_hand|flame_shock|stormstrike_mh|earth_shock|darkmoon_card_hurricane|wolf_melee|searing_flames|unleash_flame|lightning_shield|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776666555555566667777666778777677776777777666677777766666777776777777777766666777777666677777777777777776666677777776776677776666666666666666777777766677777766667777776666677777777766777777777777777766667777777666777777766777777776666677777776667777766666667777666667777777666777777776677777777667777777767777777776667777777766677777777777777777766677777777766666766666666666666666666666666666666666666667766666666777776666667766666666766666666666666&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=25289&chtt=Shaman_Enh_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y55555454557787655554523233210zyywwvvvvvvvuutsrqqppppppppqqqqqpppooooppqqrrrrrqqqppppppqqqrqqqqqppppppqqqrrrqqpppppqpqqqrrsstttssttttuuuvvvvvvvuuttttttttttttssrrqqqqqqqppppoooooonnnnooopppoppppoooooppppppppoooooooooppppppppoooooooooppppppppppqqqrrsstttuuuttttuuuuuuuuuuuuttttsssssssssrrqqpppppppppppppoooooooooppppppppppoooooppppppppppoooooooppppppooooooopppppqqqqrrrrrssssstttttttttttttttuuuuuuuttttssssrrrrqqqpppppoooooooooooooopooooooopppppooopppppp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26683|max=36549&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,3,4,7,6,16,36,37,58,77,109,162,236,291,321,420,465,537,596,638,662,676,680,613,562,530,472,366,305,277,217,189,117,90,65,50,30,30,25,10,5,3,2,1,1,0,0,0,0,1&chds=0,680&chbh=5&chxt=x&chxl=0:|min=24759|avg=26683|max=29245&chxp=0,1,43,100&chtt=Shaman_Enh_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372 26683
darkmoon_card_hurricane 974 3.7% 38.5 12.00sec 11441 0 7954 16385 16385 41.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.52 38.52 0.00 0.00 0.0000 0.0000 440674
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 58.63% 7953.66 7954 7954 179618
crit 15.9 41.37% 16384.54 16385 16385 261057

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1012 3.8% 40.2 11.13sec 11396 8473 8810 13608 17108 54.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.18 40.18 0.00 0.00 1.3449 0.0000 457872
Direct Results Count Pct Average Min Max Total Damage
hit 18.4 45.83% 8809.75 8337 11073 162219
crit 21.7 54.08% 13607.58 12880 17108 295653
miss 0.0 0.09% 0.00 0 0 0

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
flame_shock 1324 5.0% 23.0 19.94sec 26071 19442 6014 9283 12271 19.3% 0.1% 0.0% 0.0% 155 2599 4015 19.3% 0.0% 90.9%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.98 22.98 155.46 155.46 1.3410 2.6441 599067
Direct Results Count Pct Average Min Max Total Damage
hit 18.5 80.56% 6013.61 4647 7942 111314
crit 4.4 19.35% 9283.07 7180 12271 41268
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.4 80.68% 2598.50 1992 3481 325933
crit 30.0 19.32% 4014.72 3078 5377 120552

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 2197 8.2% 339.5 1.33sec 2928 0 2651 4096 5174 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
339.46 339.46 0.00 0.00 0.0000 0.0000 993891
Direct Results Count Pct Average Min Max Total Damage
hit 273.5 80.58% 2651.10 2495 3349 725195
crit 65.6 19.33% 4095.60 3855 5174 268696
miss 0.3 0.09% 0.00 0 0 0

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_lash 3469 13.0% 43.7 10.46sec 35925 23673 24994 51578 63098 41.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.67 43.67 0.00 0.00 1.5175 0.0000 1568972
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 58.72% 24993.73 18292 30630 640934
crit 18.0 41.20% 51577.73 37682 63098 928038
dodge 0.0 0.08% 0.00 0 0 0

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3036 11.4% 69.5 6.47sec 19773 14766 14699 22663 29138 63.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
69.46 69.44 0.00 0.00 1.3391 0.0000 1373364
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 35.96% 14699.27 13799 18860 367063
crit 44.4 63.95% 22663.42 21319 29138 1006301
miss 0.1 0.09% 0.00 0 0 0

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 636 2.4% 41.8 10.89sec 6879 0 5461 8418 10738 52.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.82 41.82 0.00 0.00 0.0000 0.0000 287722
Direct Results Count Pct Average Min Max Total Damage
hit 18.8 44.98% 5460.99 5130 6950 102739
crit 22.0 52.54% 8418.21 7926 10738 184983
miss 0.0 0.09% 0.00 0 0 0
none 1.0 2.39% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2894 10.8% 285.3 1.59sec 4588 2958 3498 7211 8743 41.4% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
285.30 285.30 0.00 0.00 1.5513 0.0000 1308984
Direct Results Count Pct Average Min Max Total Damage
hit 79.2 27.75% 3498.09 3338 4244 276904
crit 118.2 41.43% 7211.14 6876 8743 852366
glance 68.5 24.00% 2624.61 2503 3183 179714
dodge 0.2 0.09% 0.00 0 0 0
miss 19.2 6.74% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1443 5.4% 284.4 1.59sec 2294 1475 1749 3605 4371 41.4% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
284.43 284.43 0.00 0.00 1.5550 0.0000 652505
Direct Results Count Pct Average Min Max Total Damage
hit 78.9 27.73% 1748.84 1669 2122 137931
crit 117.9 41.45% 3605.29 3438 4371 425024
glance 68.2 23.99% 1312.10 1252 1592 89549
dodge 0.2 0.09% 0.00 0 0 0
miss 19.2 6.74% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 790 3.0% 279.6 1.62sec 1278 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122 2723 4207 14.3% 0.0% 80.8%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.59 279.59 121.77 121.77 0.0000 3.0000 357446
Direct Results Count Pct Average Min Max Total Damage
hit 279.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.3 85.69% 2723.19 716 4945 284136
crit 17.4 14.31% 4206.75 1106 7640 73311

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:795.11
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 2602 9.8% 8.1 59.76sec 145623 143369 0 0 0 0.0% 0.0% 0.0% 0.0% 280 3809 5885 19.3% 0.0% 99.0%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.08 8.08 279.84 279.59 1.0157 1.6000 1177117
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 225.6 80.68% 3809.24 3578 4944 859257
crit 54.0 19.32% 5884.77 5528 7639 317859

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 123.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.16 4.16 0.00 0.00 1.2922 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1569 5.9% 47.6 9.51sec 14921 9851 0 0 0 0.0% 0.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.57 47.57 0.00 0.00 1.5147 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 47.2 99.16% 0.00 0 0 0
dodge 0.4 0.84% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 1046 3.9% 47.2 9.59sec 10026 0 6968 14361 17431 41.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.17 47.17 0.00 0.00 0.0000 0.0000 472954
Direct Results Count Pct Average Min Max Total Damage
hit 27.7 58.63% 6967.91 6655 8462 192707
crit 19.5 41.37% 14361.15 13709 17431 280248

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 524 2.0% 47.2 9.59sec 5021 0 3490 7193 8716 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.17 47.17 0.00 0.00 0.0000 0.0000 236833
Direct Results Count Pct Average Min Max Total Damage
hit 27.7 58.66% 3489.54 3327 4231 96550
crit 19.5 41.34% 7193.24 6855 8716 140283

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.7 15.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.72 28.72 0.00 0.00 1.3380 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.7 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed. See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 670 2.5% 28.7 15.94sec 10551 0 9548 14750 18328 19.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.72 28.72 0.00 0.00 0.0000 0.0000 303069
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 80.47% 9547.91 9046 11899 220694
crit 5.6 19.44% 14750.11 13975 18328 82375
miss 0.0 0.09% 0.00 0 0 0

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 399 1.5% 28.7 15.94sec 6285 0 4372 9007 10828 41.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.72 28.72 0.00 0.00 0.0000 0.0000 180532
Direct Results Count Pct Average Min Max Total Damage
hit 16.8 58.53% 4371.60 4172 5256 73479
crit 11.9 41.39% 9006.63 8595 10828 107054
dodge 0.0 0.08% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 2629 9.9% 141.0 9.52sec 8438 0 5866 12089 14231 41.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
140.95 140.95 0.00 0.00 0.0000 0.0000 1189286
Direct Results Count Pct Average Min Max Total Damage
hit 82.5 58.52% 5866.28 5640 6908 483866
crit 58.4 41.40% 12088.65 11617 14231 705420
dodge 0.1 0.08% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 935
wolf_melee 935 100.0% 89.2 4.68sec 4401 3261 4672 9363 10970 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.16 89.16 0.00 0.00 1.3494 0.0000 392380
Direct Results Count Pct Average Min Max Total Damage
hit 67.6 75.80% 4671.85 4448 5485 315732
crit 0.2 0.20% 9363.35 8897 10970 1684
glance 21.4 24.00% 3503.42 3336 4114 74963

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 601
earth_melee 601 100.0% 59.0 2.00sec 1306 653 1346 2693 2815 3.0% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 77064
Direct Results Count Pct Average Min Max Total Damage
hit 43.1 72.99% 1346.23 1258 1407 57973
crit 1.8 3.04% 2692.57 2515 2815 4835
glance 14.1 23.93% 1009.71 943 1056 14257
dodge 0.0 0.04% 0.00 0 0 0

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372
bloodlust mana 0.0% 0.0 1523
earth_elemental_totem mana 0.4% 0.0 1406
earth_shock mana 12.4% 10.8 1054
flame_shock mana 6.7% 26.2 996
flametongue_oh mana 35.0% 8.3 351
lava_lash mana 12.0% 38.3 937
lightning_bolt mana 2.3% 173.4 114
searing_totem mana 0.7% 497.4 293
spirit_wolf mana 0.9% 0.0 703
stormstrike mana 26.1% 8.0 1874
unleash_elements mana 3.5% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 20219.9 11.2 31.5%
initial_mana none 1.0 25595.0 25595.0 0.0%
mp5_regen mana 1809.6 74330.3 41.1 29.8%
primal_wisdom mana 323.8 237667.7 734.0 37.3%
replenishment mana 1809.6 7986.0 4.4 31.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 9.3 83.3 49.0sec 4.8sec 92% 92%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 923.0 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 71.9 291.5 6.3sec 1.2sec 86% 86%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.8 7.8 37.6sec 22.0sec 40% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 10.4 5.0 42.0sec 27.6sec 34% 35%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 70.2 280.5 6.5sec 1.3sec 79% 86%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.5 45.7 202.9sec 9.6sec 98% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 338.9sec 338.9sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.7 0.0 15.9sec 15.9sec 33% 78%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.7 0.0 15.9sec 15.9sec 21% 30%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 38.5 12.0sec
flametongue_icd 16.4 26.1sec
maelstrom_weapon 350.8 1.5sec
static_shock 40.8 11.0sec
swings_clipped_mh 5.8 63.9sec
swings_clipped_oh 6.0 62.1sec
wasted_maelstrom_weapon 29.6 16.7sec
windfury 47.0 9.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.44%
σ of the average dps 5.4065
2 * σ / μ 0.0405%
95% Confidence Intervall ( μ ± 2σ ) ( 26672.60 - 26694.23 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26667.19 - 26699.63 )
Sample Data
σ 540.6540
Minimum 24758.73
Maximum 29245.23
Spread ( max - min ) 4486.49
Range ( max - min ) / 2 2243.25
Range% 8.41
10th Percentile 26001.47
90th Percentile 27394.19
( 90th Percentile - 10th Percentile ) 1392.72
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1642
0.1 scale factor error with delta=300 2598
0.05 scale factor error with delta=300 10393
0.01 scale factor error with delta=300 259828
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react

Sample Sequence

012378AEFGIJLHMNKQGLHKIQGJLQKHGILHKQGJLHIKQGLHKFQLGHIJLQGKHLKIGQLJQGKLHIKQGLJQKGIFHEKLHGKMQLIJHGLHKGIHJLQGKLQIKQGLJHKFGHIKHLGJLHKIGHKLHKGLIJHLGKHLIJGHLFHEKGLIJMHLGKHLIJGHLKQGKILQJGQLKHIGKFHLQJGQIKLHGKHLJIGHLHKGLKHIJGHLQKQFGIEJLHKGMHLKIGQJLHQKGIHLKQGQJLIKGHLKFQGIJHLKGQLKIHGJLQKGIHKLHGJLQIKGQLKFQGEHIJHLMGKQLIJHGLHKHLGHIJQLHGKQLQIKGFHLJQG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7775 5075 4756
Stamina 7541 5924 5775
Intellect 163 156 20
Spirit 178 178 20
Health 142355 119773 0
Mana 25595 25490 0
Spell Power 11357 5448 0
Spell Hit 16.91% 16.91% 1712
Spell Crit 16.13% 11.12% 1018
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 18248 10603 190
Melee Hit 20.25% 20.25% 1712
Melee Crit 40.53% 27.22% 1018
Melee Haste 5.13% 5.13% 657
Expertise 22.65 22.65 440
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 24.24% 16.86% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.20% 17.20% 1650

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Improved Fire Nova 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372
origin="http://chardev.org/?profile=39863"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4756
# gear_stamina=5775
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=440
# gear_hit_rating=1712
# gear_crit_rating=1018
# gear_haste_rating=657
# gear_mastery_rating=1650
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Shaman_Enh_T11_372_Caster : 26745dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26745.4 8.56 / 0.03% 29.7 900.9 896.6 mana 6.41% 40.8
Origin http://chardev.org/?profile=39882
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:23441|22742|17620|16682|10031|6996|3200|2437|1442|741&chds=0,46882&chco=C41F3B,C41F3B,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23441++lava_lash,C41F3B,0,0,15|t++22742++flame_shock,C41F3B,1,0,15|t++17620++lightning_bolt,336600,2,0,15|t++16682++lava_burst,C41F3B,3,0,15|t++10031++earth_shock,336600,4,0,15|t++6996++stormstrike,C79C6E,5,0,15|t++3200++wolf_melee,C79C6E,6,0,15|t++2437++melee_main_hand,C79C6E,7,0,15|t++1442++melee_off_hand,C79C6E,8,0,15|t++741++earth_melee,C79C6E,9,0,15&chtt=Shaman_Enh_T11_372_Caster+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x390&cht=p&chf=bg,s,333333&chd=t:14,13,12,7,7,6,6,6,4,4,4,3,3,3,3,2,2,1,1&chds=0,100&chco=336600,C41F3B,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C79C6E,336600,C79C6E,C41F3B,C79C6E,C41F3B,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E&chl=lightning_bolt|lava_lash|searing_totem|lava_burst|melee_main_hand|flametongue_oh|flame_shock|windfury_mh|earth_shock|melee_off_hand|searing_flames|wolf_melee|unleash_flame|lightning_shield|darkmoon_card_hurricane|stormstrike_mh|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372_Caster+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7877777666444456345544445565444334566544444445554444555555555554555666654433334444455555555443333445565544333344444444555555554444555666654434444455554444444443444555554433334444455555566554334445555544333344444444444444444444455555444334444555555555544444444555555444444444444444444444444444555544444445555554444444444444445555444444444444444444444444444455555555444444444555555554444444555544443344444444444444444444445555555443334444444444444444444&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=27770&chtt=Shaman_Enh_T11_372_Caster+Mana+Timeline&chts=dddddd,18&chco=2459FF http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y4434344433687755555652333321100zxxwwwvvvvvuttssrqppopopqqqqqpppppppoppqqqqqqqqqqqqqpppqqqrrqqqqqqpppqqqqqrrrqqqqqqqqqqqrrssssssssttttuuuuuuvvvuuuutttttttttsssrrqqqqppppppppppooooonnooooppooopppoooopppppppppppppoooooppppppppooooooooppppqqqqqqqqqrrrsstttttttttttuuuuuuuuuuuutttsssssssrrrqqppoooooooooooppooooooooopppppppppooooooppppppppppppooooopppppooooooooppppqqqqrrrrrssssssttttttttttttttuuuuuuttttsssrrrrqqqpppppooooooooooooooopppppoooooopppppppoooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26745|max=36663&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,1,4,6,12,21,27,42,69,94,145,193,256,279,388,406,514,524,631,607,676,662,657,639,534,521,449,350,326,228,182,154,119,69,56,56,42,19,12,13,2,5,4,2,1,0,0,1&chds=0,676&chbh=5&chxt=x&chxl=0:|min=25112|avg=26745|max=28653&chxp=0,1,46,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372_Caster 26745
darkmoon_card_hurricane 744 2.8% 29.2 15.71sec 11505 0 8040 16562 16562 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.25 29.25 0.00 0.00 0.0000 0.0000 336482
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 59.34% 8039.87 8040 8040 139520
crit 11.9 40.66% 16562.13 16562 16562 196962

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1183 4.4% 39.7 11.25sec 13481 10031 10429 16109 19757 53.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.68 39.68 0.00 0.00 1.3439 0.0000 534906
Direct Results Count Pct Average Min Max Total Damage
hit 18.4 46.26% 10429.14 10022 12787 191421
crit 21.3 53.74% 16108.91 15483 19757 343486

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
flame_shock 1548 5.8% 22.9 20.05sec 30607 22742 7014 10842 14164 18.8% 0.0% 0.0% 0.0% 155 3063 4732 19.0% 0.0% 90.9%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.88 22.88 154.82 154.82 1.3458 2.6558 700370
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 81.18% 7014.00 5582 9167 130296
crit 4.3 18.82% 10842.28 8624 14164 46688
Tick Results Count Pct Average Min Max Total Damage
hit 125.4 81.00% 3063.50 2427 4050 384156
crit 29.4 19.00% 4732.16 3750 6258 139229

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 1736 6.5% 272.9 1.66sec 2877 0 2607 4028 5146 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
272.89 272.89 0.00 0.00 0.0000 0.0000 785123
Direct Results Count Pct Average Min Max Total Damage
hit 221.1 81.01% 2607.19 2468 3331 576383
crit 51.8 18.99% 4028.12 3813 5146 208740

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_burst 1996 7.5% 29.8 14.91sec 30282 16682 0 30292 41647 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.81 29.80 0.00 0.00 1.8153 0.0000 902662
Direct Results Count Pct Average Min Max Total Damage
crit 29.8 100.00% 30292.40 27821 41647 902662

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_lash 3348 12.5% 42.8 10.67sec 35374 23441 24673 50937 62931 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
42.80 42.80 0.00 0.00 1.5091 0.0000 1514114
Direct Results Count Pct Average Min Max Total Damage
hit 25.4 59.26% 24672.58 18215 30549 625793
crit 17.4 40.74% 50936.70 37523 62931 888321

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3807 14.2% 72.4 6.20sec 23773 17620 17674 27266 34011 63.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.43 72.40 0.00 0.00 1.3492 0.0000 1721839
Direct Results Count Pct Average Min Max Total Damage
hit 26.3 36.33% 17674.07 16897 22013 464913
crit 46.1 63.67% 27265.79 26106 34011 1256926

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 749 2.8% 41.1 11.03sec 8234 0 6541 10088 12493 52.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.13 41.13 0.00 0.00 0.0000 0.0000 338662
Direct Results Count Pct Average Min Max Total Damage
hit 18.7 45.37% 6541.32 6246 8086 122052
crit 21.5 52.20% 10088.45 9651 12493 216610
none 1.0 2.43% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 1794 6.7% 311.3 1.46sec 2607 2437 2012 4147 5234 40.7% 7.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
311.26 311.26 0.00 0.00 1.0700 0.0000 811527
Direct Results Count Pct Average Min Max Total Damage
hit 86.3 27.71% 2012.24 1913 2541 173576
crit 126.6 40.69% 4147.29 3942 5234 525198
glance 74.7 24.00% 1509.50 1435 1906 112754
dodge 1.6 0.50% 0.00 0 0 0
miss 22.1 7.10% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1036 3.9% 210.4 2.15sec 2226 1442 1712 3528 4313 40.7% 7.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.41 210.41 0.00 0.00 1.5444 0.0000 468450
Direct Results Count Pct Average Min Max Total Damage
hit 59.4 28.24% 1711.92 1641 2094 101740
crit 85.5 40.65% 3528.00 3380 4313 301772
glance 50.6 24.03% 1284.18 1230 1570 64938
miss 14.9 7.07% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 966 3.6% 279.2 1.62sec 1565 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122 3327 5144 14.0% 0.0% 80.9%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.23 279.23 122.04 122.04 0.0000 3.0000 436992
Direct Results Count Pct Average Min Max Total Damage
hit 279.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 105.0 86.03% 3326.91 883 5795 349298
crit 17.0 13.97% 5144.26 1364 8953 87693

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:882.58
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 3145 11.8% 8.1 59.91sec 176368 174093 0 0 0 0.0% 0.0% 0.0% 0.0% 279 4617 7134 19.0% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.06 8.06 279.23 279.23 1.0131 1.6000 1422370
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 226.3 81.04% 4616.65 4413 5794 1044636
crit 53.0 18.96% 7133.56 6818 8951 377733

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 122.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.17 4.17 0.00 0.00 1.2974 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1090 4.1% 46.7 9.69sec 10565 6996 0 0 0 0.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.65 46.65 0.00 0.00 1.5101 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.4 99.51% 0.00 0 0 0
dodge 0.2 0.49% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 588 2.2% 46.4 9.74sec 5732 0 4002 8248 10435 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.42 46.42 0.00 0.00 0.0000 0.0000 266074
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 59.27% 4002.25 3815 5066 110112
crit 18.9 40.73% 8247.60 7859 10435 155962

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 501 1.9% 46.4 9.74sec 4885 0 3411 7029 8599 40.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.42 46.42 0.00 0.00 0.0000 0.0000 226783
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 59.25% 3410.88 3271 4174 93813
crit 18.9 40.75% 7028.61 6738 8599 132969

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.6 16.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.57 28.57 0.00 0.00 1.3413 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.6 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed. See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 787 2.9% 28.6 16.03sec 12457 0 11291 17442 21271 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.57 28.57 0.00 0.00 0.0000 0.0000 355910
Direct Results Count Pct Average Min Max Total Damage
hit 23.2 81.04% 11291.42 10847 13768 261438
crit 5.4 18.96% 17441.52 16759 21271 94472

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 226 0.8% 28.6 16.03sec 3574 0 2509 5170 6496 40.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.57 28.56 0.00 0.00 0.0000 0.0000 102114
Direct Results Count Pct Average Min Max Total Damage
hit 16.9 59.01% 2509.50 2392 3153 42296
crit 11.6 40.51% 5170.17 4927 6496 59818
dodge 0.1 0.49% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 1546 5.8% 140.8 9.55sec 4967 0 3484 7180 8706 40.6% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
140.77 140.77 0.00 0.00 0.0000 0.0000 699199
Direct Results Count Pct Average Min Max Total Damage
hit 82.9 58.91% 3483.75 3348 4226 288915
crit 57.1 40.59% 7179.88 6897 8706 410284
dodge 0.7 0.50% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 919
wolf_melee 919 100.0% 89.4 4.67sec 4318 3200 4583 9169 10840 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.35 89.35 0.00 0.00 1.3495 0.0000 385804
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 75.81% 4583.07 4384 5420 310434
crit 0.2 0.21% 9169.30 8767 10840 1691
glance 21.4 23.99% 3437.81 3288 4065 73680

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 682
earth_melee 682 100.0% 59.0 2.00sec 1482 741 1528 3055 3182 3.0% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 87415
Direct Results Count Pct Average Min Max Total Damage
hit 43.0 72.94% 1527.72 1498 1591 65748
crit 1.8 3.00% 3054.54 2997 3182 5403
glance 14.2 24.06% 1145.82 1124 1193 16265

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372_Caster
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 10.3% 12.8 1054
flame_shock mana 5.6% 30.7 996
flametongue_oh mana 23.5% 8.2 351
lava_burst mana 17.1% 12.9 2343
lava_lash mana 9.8% 37.8 937
lightning_bolt mana 7.7% 55.1 431
searing_totem mana 0.6% 602.5 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 21.5% 5.6 1874
unleash_elements mana 2.9% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 23832.3 13.2 19.2%
initial_mana none 1.0 28205.0 28205.0 0.0%
mp5_regen mana 1809.6 86428.3 47.8 18.4%
primal_wisdom mana 303.7 284949.6 938.2 19.9%
replenishment mana 1809.6 10332.4 5.7 19.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 4.7 118.3 92.8sec 3.6sec 97% 97%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 862.0 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 66.3 269.8 6.8sec 1.3sec 85% 85%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 9.8 4.3 44.2sec 29.8sec 31% 33%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.0 3.3 47.7sec 33.9sec 28% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 73.1 192.4 6.2sec 1.7sec 72% 67%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.4 45.1 221.5sec 9.7sec 99% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 338.5sec 338.5sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.6 0.0 16.0sec 16.0sec 28% 42%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.6 0.0 16.0sec 16.0sec 21% 29%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 29.2 15.7sec
flametongue_icd 11.9 35.7sec
maelstrom_weapon 265.6 1.9sec
static_shock 40.1 11.2sec
swings_clipped_mh 38.4 11.5sec
swings_clipped_oh 28.8 15.2sec
wasted_maelstrom_weapon 13.0 33.9sec
windfury 46.9 9.6sec

Statistics & Data Analysis

DPS
Population
Convergence 71.09%
σ of the average dps 4.2818
2 * σ / μ 0.0320%
95% Confidence Intervall ( μ ± 2σ ) ( 26736.84 - 26753.97 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26732.56 - 26758.25 )
Sample Data
σ 428.1775
Minimum 25112.46
Maximum 28652.65
Spread ( max - min ) 3540.19
Range ( max - min ) / 2 1770.09
Range% 6.62
10th Percentile 26206.44
90th Percentile 27297.75
( 90th Percentile - 10th Percentile ) 1091.31
Approx. Iterations needed for
1% dps error 10
0.1% dps error 1025
0.1 scale factor error with delta=300 1629
0.05 scale factor error with delta=300 6518
0.01 scale factor error with delta=300 162965
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
R lava_burst,if=dot.flame_shock.remains>cast_time+0.5

Sample Sequence

012378AEFGIHJLMNHRGKLHIJQRGLKHQRKGILQJRGKLQIKQGLQKFQLGHIJQLQRGKLQIJQGLQKRLGIJQQLQKGRLKIQFEGJLQRKMGILKQRGJHLHIKHGLRKQLGHIJRLQGKHFLIJGQRKLQGKILQJRGLKQIRGKLHQJRGHIKLQRGFKLEHIJGQLMKQRGKILHQJRGLKQIQRGKLHQJGILHKRFGLKQIQJGLQRKLGIJQRLKGHQKILQGJRLQKGIRKFLQEGJQRLIKGHMLKRGQIJLHRGKQLQIJGHLQKQRGKIFLHJRGQKLQIQGJHLRKQGIKLQRKGQLQJIRGKLQKQGFIJELHRGKQLQIJGMHLKQRGKIHLQJRGQKLQIQKGLQKQFQGIJL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7593 4901 4591
Stamina 7540 5923 5774
Intellect 337 321 185
Spirit 244 244 86
Health 142341 119759 0
Mana 28205 27965 0
Spell Power 13755 7646 2207
Spell Hit 17.15% 17.15% 1671
Spell Crit 15.79% 10.76% 908
Spell Haste 9.85% 4.62% 591
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 17848 10257 190
Melee Hit 19.91% 19.91% 1671
Melee Crit 39.36% 26.07% 908
Melee Haste 4.62% 4.62% 591
Expertise 24.02 24.02 481
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.79% 16.40% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.82% 17.82% 1760

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Improved Fire Nova 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372_Caster
origin="http://chardev.org/?profile=39882"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
actions+=/lava_burst,if=dot.flame_shock.remains>cast_time+0.5
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4591
# gear_stamina=5774
# gear_intellect=185
# gear_spirit=86
# gear_spell_power=2207
# gear_attack_power=190
# gear_expertise_rating=481
# gear_hit_rating=1671
# gear_crit_rating=908
# gear_haste_rating=591
# gear_mastery_rating=1760
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=andoros_fist_of_the_dragon_king,heroic=1,weapon=mace_1.80speed_328min_611max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Warlock_AffDrain_T11_372 : 26666dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26666.0 10.32 / 0.04% 17.2 1551.5 1528.2 mana 0.00% 35.6
Origin http://chardev.org/?profile=36745
Talents http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • lash_of_pain
  • haunt

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:71941|21705|16771|15760|15662|13485|8993|8423|5114|1390|519&chds=0,143882&chco=9482C9,435133,9482C9,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++71941++unstable_affliction,9482C9,0,0,15|t++21705++fel_flame,435133,1,0,15|t++16771++shadowflame,9482C9,2,0,15|t++15760++shadow_bolt,9482C9,3,0,15|t++15662++drain_soul,9482C9,4,0,15|t++13485++soul_fire,C41F3B,5,0,15|t++8993++drain_life,9482C9,6,0,15|t++8423++haunt,9482C9,7,0,15|t++5114++lash_of_pain,9482C9,8,0,15|t++1390++infernal_melee,C79C6E,9,0,15|t++519++ebon_imp_melee,C79C6E,10,0,15&chtt=Warlock_AffDrain_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:19,15,15,14,13,9,4,3,3,1,1,1,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B,9482C9,435133,C79C6E,9482C9,C79C6E,C41F3B,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|unstable_affliction|drain_life|corruption|drain_soul|bane_of_doom|haunt|shadowflame_dot|shadow_bolt|fel_flame|infernal_melee|shadowflame|ebon_imp_melee|infernal_immolation|soul_fire|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_AffDrain_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s78665yuuuuuuuuutssrqqqqpoooooomlkjjjiiiiiihgfeeedeeeddddccbbbbaZZZZZYYYXWVVVVVVVVUUTSSSSSSRRRRRQQQQQQQQQQQRQQQQPPPPPPPPPPOONNMNNNNNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOONNNNNNNNNNNNMMMMMMMMMMNMMMMMMMMNNNOOOOOOOONOOOONNNNNNNNNNMNNNNNNNNMMMMMMNNNNNNNNNNOONNNNNNNNNNNNNNNNNNNNNMMMMMMMNNMNMMMMMNNNOOOOOOOOOOOOPOOPOPPPOOOOOOOOOPPPPPPPPPQQQQRRRRRSSSTTTTUUUUUVVVVVVWWWWWWXXXXXXXXXXXXWWWWWWXXXXYYYYYZZZZaaaaabbbbbbcccddddddeeeefffffgggghhhiiiiiiiiiiijjjkkkllllllmmmnn&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=106619&chtt=Warlock_AffDrain_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:lmpsqrstwxwz234576644101z10zyvutsqrqporqqqppnnmmlkkkknnmmmmjihhhihhghiiihheeeeedddefgggggfeeffgghhikkkklkjkkkkkkkmmmlllkjjjiiihhhijjjjihhhhhhhhijkkkkkjiiiiihhhijjjiigfeeeeeeegggfffeddeeefffghiiiihhhhhiiiiijjjjjihhhhhhhhijjkkkjiiiiiiiijkkkkkkjiiiiiiiijjkjjihgggfffffgghhhggfefffffghjjkkkjjjjjjjjjklllkkjiihhhhhhiijkkkkjjkkllmmnopqqrrqqppqpppqqrrrqqponmmmlllmmmmmmlkkkkklllmnoppppopppqqqqqrrsssrqppooooooopppppoonnnooopqrsssssssssttuuvvwxxxwvvvvvvvwvvwvw&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26666|max=42330&chxp=1,1,63,100&chtt=Warlock_AffDrain_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,2,9,7,18,32,55,101,109,167,214,282,364,427,520,551,650,665,646,638,638,575,572,474,450,399,316,236,225,174,113,98,76,66,39,23,19,18,5,10,5,5,1,0,1,2,0,0,1&chds=0,665&chbh=5&chxt=x&chxl=0:|min=24846|avg=26666|max=28950&chxp=0,1,44,100&chtt=Warlock_AffDrain_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_AffDrain_T11_372 26666
bane_of_doom 2333 8.8% 7.6 60.79sec 138026 134926 0 0 0 0.0% 0.1% 0.0% 0.0% 29 26781 55439 33.2% 0.0% 96.4%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.64 7.64 29.05 29.05 1.0230 15.0000 1054796
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 66.77% 26781.28 18549 39574 519506
crit 9.7 33.23% 55438.92 38115 81318 535290

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 3832 14.4% 1.0 1.03sec 1729679 1667990 0 0 0 0.0% 0.1% 0.0% 0.0% 208 5838 12082 40.1% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 207.67 207.67 1.0370 2.1677 1732100
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.86% 0.00 0 0 0
miss 0.0 0.14% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.4 59.92% 5838.37 3573 9203 726560
crit 83.2 40.08% 12081.67 7342 19598 1005540

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.3% 10.1 46.54sec 3097 0 2698 4176 4896 27.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 31318
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.71% 2697.89 2602 3169 19838
crit 2.7 27.19% 4175.54 4020 4896 11479
miss 0.0 0.10% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 2.9 133.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.90 2.90 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.9 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 3983 14.9% 101.4 3.29sec 17756 8993 0 0 0 0.0% 0.1% 0.0% 0.0% 230 6190 12836 24.9% 0.0% 36.4%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
101.42 101.42 229.54 229.54 1.9743 0.7171 1800770
Direct Results Count Pct Average Min Max Total Damage
hit 101.3 99.89% 0.00 0 0 0
miss 0.1 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 172.4 75.10% 6189.93 3701 9340 1067056
crit 57.2 24.90% 12836.36 7604 19193 733714

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3350 12.6% 13.1 8.76sec 115726 15662 0 0 0 0.0% 0.1% 0.0% 0.0% 42 28243 58563 25.4% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.09 13.09 42.15 42.15 7.3887 2.2214 1514436
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.5 74.64% 28242.93 16496 40868 888534
crit 10.7 25.36% 58563.42 35621 83977 625902

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 306 1.1% 5.6 32.19sec 24466 21705 19338 40041 59641 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.65 5.65 0.00 0.00 1.1272 0.0000 138216
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 75.01% 19338.31 17198 29025 81950
crit 1.4 24.87% 40041.22 35339 59641 56266
miss 0.0 0.11% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 962 3.6% 45.2 9.99sec 9614 8423 7614 15785 24022 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.23 45.05 0.00 0.00 1.1414 0.0000 434887
Direct Results Count Pct Average Min Max Total Damage
hit 33.7 74.82% 7613.57 6621 11714 256625
crit 11.3 25.07% 15785.12 13606 24022 178261
miss 0.1 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:709.24
  • base_dd_max:709.24
infernal_awakening 38 0.1% 1.0 0.00sec 17118 0 13236 27444 29899 27.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 17118
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 72.52% 13236.05 10344 14551 9599
crit 0.3 27.40% 27443.65 21256 29899 7520
miss 0.0 0.08% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
life_tap 0 0.0% 4.3 54.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.25 4.25 0.00 0.00 1.0145 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 794 3.0% 20.2 16.01sec 17767 15760 14007 29149 45864 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.19 20.19 0.00 0.00 1.1273 0.0000 358805
Direct Results Count Pct Average Min Max Total Damage
hit 15.1 74.94% 14007.10 12023 22320 211983
crit 5.0 24.94% 29149.23 24705 45864 146822
miss 0.0 0.12% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1088 4.1% 26.0 13.12sec 18938 16771 2509 5186 6805 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.96 25.96 0.00 0.00 1.1292 0.0000 82394
Direct Results Count Pct Average Min Max Total Damage
hit 19.5 74.96% 2508.98 2313 3312 48823
crit 6.5 24.93% 5186.37 4753 6805 33571
miss 0.0 0.11% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 905 3.4% 26.0 13.12sec 15764 0 0 0 0 25.1% 0.1% 0.0% 0.0% 113 2849 5916 25.1% 0.0% 35.8%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.96 25.96 113.09 113.09 0.0000 1.4325 409236
Direct Results Count Pct Average Min Max Total Damage
hit 19.4 74.82% 0.00 0 0 0
crit 6.5 25.07% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 84.7 74.90% 2848.98 2489 4196 241328
crit 28.4 25.10% 5915.96 5114 8622 167908

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 100 0.4% 3.0 46.24sec 15113 13485 11641 24238 29262 27.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1207 0.0000 45338
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.25% 11640.80 9322 14240 25233
crit 0.8 27.65% 24237.73 19154 29262 20105
miss 0.0 0.10% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4099 15.4% 22.6 15.39sec 82164 71941 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6243 12916 40.1% 0.0% 99.1%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.55 22.55 207.80 207.80 1.1421 2.1570 1853141
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.5 59.92% 6243.06 3818 10082 777282
crit 83.3 40.08% 12916.49 7846 20003 1075858

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - succubus 5131
lash_of_pain 5131 100.0% 301.2 1.51sec 7698 5114 6114 12303 18163 26.6% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.16 301.16 0.00 0.00 1.5051 0.0000 2318232
Direct Results Count Pct Average Min Max Total Damage
hit 218.1 72.43% 6114.07 5396 9104 1333680
crit 80.0 26.57% 12303.21 10766 18163 984552
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 3558
infernal_immolation 1151 32.3% 1.0 0.00sec 58902 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2704 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0000 0.0000 58902
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 99.03% 2703.59 2215 3830 58902
miss 0.2 0.97% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2407 67.7% 58.0 0.75sec 2124 1390 2169 4447 5478 17.3% 14.4% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 1.5284 0.0000 123179
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 44.15% 2169.25 1948 2739 55553
crit 10.1 17.35% 4446.94 3895 5478 44746
glance 14.0 24.08% 1637.96 1461 2054 22880
dodge 3.8 6.48% 0.00 0 0 0
miss 4.6 7.93% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 206
ebon_imp_melee 206 100.0% 103.3 0.78sec 793 519 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
103.29 103.29 0.00 0.00 1.5284 0.0000 81890
Direct Results Count Pct Average Min Max Total Damage
hit 46.1 44.62% 822.05 822 822 37889
crit 17.5 16.92% 1644.11 1644 1644 28728
glance 24.8 23.98% 616.54 617 617 15274
dodge 6.7 6.50% 0.00 0 0 0
miss 8.2 7.98% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_AffDrain_T11_372
bane_of_doom mana 3.4% 44.8 3082
corruption mana 0.2% 1402.8 1233
demon_soul mana 1.3% 0.0 3082
drain_life mana 35.7% 7.2 2466
drain_soul mana 5.4% 40.2 2877
fel_flame mana 1.0% 19.8 1233
haunt mana 15.9% 3.9 2466
infernal mana 2.3% 0.0 16442
shadow_bolt mana 5.0% 10.2 1746
shadowflame mana 19.0% 3.7 5138
soul_fire mana 0.8% 8.2 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 9.9% 26.7 3082
pet - succubus
lash_of_pain mana 100.0% 13.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29290.5 16.2 0.7%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 4.3 140228.4 32976.3 0.0%
mana_feed mana 80.0 371039.3 4636.6 0.8%
mp5_regen mana 1809.6 92267.4 51.0 0.7%
replenishment mana 1809.6 52161.6 28.8 0.7%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_feed mana 4.3 437.3 102.8 99.5%
mana_spring_totem mana 1809.6 8862.0 4.9 70.0%
mp5_regen mana 1809.6 154028.4 85.1 61.6%
replenishment mana 1809.6 8822.1 4.9 69.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.6sec 106.6sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 68.9 0.0 6.6sec 6.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.5sec 46.5sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_succubus 2.9 0.0 134.0sec 134.0sec 13% 31%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.7sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.2 43.8 296.4sec 10.0sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.9 0.0 47.5sec 47.5sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.2 64.0 324.4sec 6.9sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 23.2 2.7 18.4sec 16.5sec 16% 100%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.2sec 46.2sec 0% 1%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.1sec 78.6sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.8sec 363.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.4sec
shadow_trance 25.9 16.5sec

Statistics & Data Analysis

DPS
Population
Convergence 68.36%
σ of the average dps 5.1623
2 * σ / μ 0.0387%
95% Confidence Intervall ( μ ± 2σ ) ( 26655.68 - 26676.33 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26650.52 - 26681.49 )
Sample Data
σ 516.2294
Minimum 24846.35
Maximum 28950.25
Spread ( max - min ) 4103.90
Range ( max - min ) / 2 2051.95
Range% 7.70
10th Percentile 25913.51
90th Percentile 27181.66
( 90th Percentile - 10th Percentile ) 1268.15
Approx. Iterations needed for
1% dps error 14
0.1% dps error 1499
0.1 scale factor error with delta=300 2368
0.05 scale factor error with delta=300 9475
0.01 scale factor error with delta=300 236882
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 corruption,if=(!ticking|remains<tick_time)&miss_react
9 unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
A bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
B haunt
C fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
D summon_infernal
E drain_soul,interrupt=1,if=target.health_pct<=25
F shadowflame
G soulburn
H soul_fire,if=buff.soulburn.up
I demon_soul,if=buff.shadow_trance.react
J shadow_bolt,if=buff.shadow_trance.react
K life_tap,mana_percentage<=5
L drain_life,interrupt=1
M life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
N fel_flame,moving=1
O life_tap

Sample Sequence

012346789ABDFGHLLLBC9LFIJLBLCLLLFB9JLLLBLFL9LBGHLFLL9BAJLLFJBLL9LLBFJLLJLB9LFLGHLBLL9FLBLLLL96BFALLLBL9LFLLBLKCLFLBL9IJLLBFJLJL9BJLFLJLBL9ALKFLBLLJ9LBFLLCLBCLFLL9BLLFLBLK9LLLBF6LLAL9BLFLLBL9LFLBLLL9FBLLLLBLF9KLLBIJLLFJA9BLLLFBJL9LJLBFLJL9JBLFLKLBL9LJLFLBLL6L9BAFJLLBKL9FLLBLLL9FBLLLBL9FLEBEBEAEBE7EBEBEBEBE6EABEBEBEBEBEBE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 152668 128504 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 0
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_AffDrain_T11_372
origin="http://chardev.org/?profile=36745"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
glyphs=life_tap/shadow_bolt/corruption/lash_of_pain/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_infernal
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/demon_soul,if=buff.shadow_trance.react
actions+=/shadow_bolt,if=buff.shadow_trance.react
actions+=/life_tap,mana_percentage<=5
actions+=/drain_life,interrupt=1
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Affliction_T11_372 : 26703dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26703.5 10.45 / 0.04% 19.2 1391.9 1235.2 mana 0.00% 36.9
Origin http://chardev.org/?profile=36750
Talents http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • lash_of_pain
  • haunt

Charts

http://7.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:72451|22047|16988|15664|13589|9961|8544|5114|1390|519&chds=0,144902&chco=9482C9,435133,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++72451++unstable_affliction,9482C9,0,0,15|t++22047++fel_flame,435133,1,0,15|t++16988++shadowflame,9482C9,2,0,15|t++15664++drain_soul,9482C9,3,0,15|t++13589++soul_fire,C41F3B,4,0,15|t++9961++shadow_bolt,9482C9,5,0,15|t++8544++haunt,9482C9,6,0,15|t++5114++lash_of_pain,9482C9,7,0,15|t++1390++infernal_melee,C79C6E,8,0,15|t++519++ebon_imp_melee,C79C6E,9,0,15&chtt=Warlock_Affliction_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:19,18,15,14,13,9,4,3,1,1,1,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B,435133,C79C6E,C79C6E,9482C9,C41F3B,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|shadow_bolt|unstable_affliction|corruption|drain_soul|bane_of_doom|haunt|shadowflame_dot|fel_flame|infernal_melee|ebon_imp_melee|shadowflame|infernal_immolation|soul_fire|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Affliction_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t78644vrqpoonnmlkjjhfffedcccbbaYXWcjllllkkkjigfeeddddehknooooonnlkkkjjihgfeddcccbbaZZYZZbeghijkkjjihgffeeffgghhhggggghiijjjjihggfedcbbaaZZZZabegijkkkjjihhgffeeeddccbbaabbcdfghiijiihhggfedccccdegiklmmmmmllkjiihggffeedccbaaaaaabccdefghhhhhhgggfffffffghijjkkkkjjiihhgffeeddcbbaaaaabcdefghhiihhgggffeeeeddddccccccccdeeeeeeeeddccbbbbabbccdeeffffffeeedddcccbbbaaaaZZZZZZZZZZZZZZZZZYYYYYYYYZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYXXXXXXXXXXXXWWVVVVVVVVVVVVVUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105268&chtt=Warlock_Affliction_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:gilooqrsvwwz125586656435220zyvutsrrppoqqppoolmlllkkjjlmllkkhhhhhggffghhhhheddddddddeeffffeeeeeefffhiijjkjiijjjjjjkllllljiiihihhhhijjjjhggggggghhijjjjjihhhhhhhhiiiiihgfeeeddddefffffeddddddeeefghhhggffggggghhiijjiihhhhhhhhiijjjiihhhhhhhhijjjjjihhhhhhhhhijjiihgggfffffgghhhhgffeeeeffgghiijjiiiiiiiijkklkkkjihhhhhhhiijjkkjjjjkkllmmnoppqpppooooooppqqqpponmmmllllmmmmllkkkkkkkkllmnooooooooppppqqrrrrqqpoooonnooppppoonnnnnooppqrrrrrrrrsssttuvvwwwvvuuvvvvvvvvv&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26703|max=43229&chxp=1,1,62,100&chtt=Warlock_Affliction_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:6,8,17,23,36,49,62,84,119,153,223,262,305,365,449,483,560,590,600,571,614,584,568,489,448,403,379,285,239,225,192,148,96,98,81,36,41,35,21,13,16,6,5,3,3,2,1,3,0,1&chds=0,614&chbh=5&chxt=x&chxl=0:|min=25052|avg=26703|max=28804&chxp=0,1,44,100&chtt=Warlock_Affliction_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Affliction_T11_372 26703
bane_of_doom 2329 8.7% 7.6 60.92sec 138081 136576 0 0 0 0.0% 0.1% 0.0% 0.0% 29 26806 55445 33.2% 0.0% 96.2%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.63 7.63 28.99 28.99 1.0110 15.0000 1053022
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 66.76% 26806.20 18549 39652 518759
crit 9.6 33.24% 55445.04 38115 81318 534263

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 3870 14.5% 1.0 188.18sec 1687808 1623409 0 0 0 0.0% 0.0% 0.0% 0.0% 208 5873 12160 40.1% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.04 1.04 208.40 208.40 1.0397 2.1602 1749413
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.95% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.8 59.89% 5873.33 4002 9203 733106
crit 83.6 40.11% 12159.68 8224 18911 1016307

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.3% 10.1 46.72sec 3091 0 2696 4173 4896 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.08 10.08 0.00 0.00 0.0000 0.0000 31151
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.93% 2696.16 2602 3169 19814
crit 2.7 26.96% 4172.93 4020 4896 11337
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_soul 3343 12.5% 13.1 8.70sec 115053 15664 0 0 0 0.0% 0.1% 0.0% 0.0% 42 28278 58577 25.3% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.14 13.14 42.05 42.05 7.3449 2.2211 1511322
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.4 74.71% 28278.09 17335 40868 888359
crit 10.6 25.29% 58576.69 35621 83977 622963

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 303 1.1% 5.6 33.13sec 24496 22047 19352 40107 59641 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.60 5.60 0.00 0.00 1.1111 0.0000 137084
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 75.04% 19351.70 17198 29025 81264
crit 1.4 24.87% 40106.78 35339 59641 55821
miss 0.0 0.09% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 954 3.6% 44.8 10.08sec 9621 8544 7625 15790 24071 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.83 44.65 0.00 0.00 1.1260 0.0000 431324
Direct Results Count Pct Average Min Max Total Damage
hit 33.4 74.87% 7625.39 6621 11714 254899
crit 11.2 25.02% 15790.05 13606 24071 176425
miss 0.0 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:709.24
  • base_dd_max:709.24
infernal_awakening 38 0.1% 1.0 0.00sec 17301 0 13255 27320 29899 28.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 17301
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.02% 13255.21 10344 14551 9414
crit 0.3 28.87% 27319.86 21256 29899 7887
miss 0.0 0.11% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
life_tap 0 0.0% 11.7 27.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.71 11.71 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 11.7 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 4806 18.0% 124.0 2.69sec 17518 9961 13830 28719 45864 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.01 124.01 0.00 0.00 1.7587 0.0000 2172492
Direct Results Count Pct Average Min Max Total Damage
hit 93.0 75.01% 13829.71 12023 22320 1286422
crit 30.9 24.88% 28718.83 24705 45864 886071
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1068 4.0% 25.5 13.37sec 18943 16988 2510 5185 6805 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.49 25.49 0.00 0.00 1.1151 0.0000 80895
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 74.97% 2509.64 2313 3312 47964
crit 6.4 24.91% 5184.98 4753 6805 32930
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 889 3.3% 25.5 13.37sec 15770 0 0 0 0 25.0% 0.1% 0.0% 0.0% 111 2849 5914 25.0% 0.0% 35.2%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.49 25.49 111.20 111.20 0.0000 1.4307 402041
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 74.87% 0.00 0 0 0
crit 6.4 25.01% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 83.4 75.00% 2849.26 2489 4196 237621
crit 27.8 25.00% 5914.49 5114 8622 164419

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 101 0.4% 3.0 46.85sec 15203 13589 11725 24379 29262 27.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1188 0.0000 45609
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.33% 11725.34 9322 14240 25443
crit 0.8 27.57% 24378.74 19154 29262 20166
miss 0.0 0.10% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4111 15.4% 22.6 15.40sec 82295 72451 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6259 12956 40.0% 0.0% 99.1%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.58 22.58 207.86 207.86 1.1359 2.1563 1858409
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.6 59.96% 6259.43 4277 9734 780177
crit 83.2 40.04% 12956.22 8788 20003 1078232

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - succubus 5131
lash_of_pain 5131 100.0% 301.2 1.51sec 7697 5114 6112 12301 18163 26.6% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.16 301.16 0.00 0.00 1.5051 0.0000 2318120
Direct Results Count Pct Average Min Max Total Damage
hit 218.1 72.41% 6112.41 5396 9104 1332904
crit 80.1 26.59% 12300.98 10766 18163 985215
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 3559
infernal_immolation 1150 32.3% 1.0 0.00sec 58847 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2702 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0000 0.0000 58847
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 99.00% 2701.84 2215 3830 58847
miss 0.2 1.00% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2409 67.7% 58.0 0.75sec 2125 1390 2169 4446 5478 17.4% 14.4% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 1.5284 0.0000 123250
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 44.17% 2168.66 1948 2739 55553
crit 10.1 17.42% 4446.21 3895 5478 44915
glance 13.9 23.98% 1637.78 1461 2054 22781
dodge 3.7 6.46% 0.00 0 0 0
miss 4.6 7.97% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 206
ebon_imp_melee 206 100.0% 102.8 0.78sec 792 519 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.76 102.76 0.00 0.00 1.5284 0.0000 81439
Direct Results Count Pct Average Min Max Total Damage
hit 45.9 44.66% 822.05 822 822 37727
crit 17.3 16.88% 1644.11 1644 1644 28523
glance 24.6 23.97% 616.54 617 617 15189
dodge 6.7 6.48% 0.00 0 0 0
miss 8.2 8.00% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Affliction_T11_372
bane_of_doom mana 3.7% 44.8 3082
corruption mana 0.2% 1368.9 1233
demon_soul mana 1.6% 0.0 3082
drain_soul mana 6.0% 40.0 2877
fel_flame mana 1.1% 19.9 1233
haunt mana 17.6% 3.9 2466
infernal mana 2.6% 0.0 16442
shadow_bolt mana 34.4% 10.0 1746
shadowflame mana 20.8% 3.7 5138
soul_fire mana 0.9% 8.2 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 11.1% 26.7 3082
pet - succubus
lash_of_pain mana 100.0% 13.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29434.8 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 11.7 377994.6 32289.8 0.0%
mp5_regen mana 1809.6 92714.9 51.2 0.2%
replenishment mana 1809.6 52378.9 28.9 0.2%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_spring_totem mana 1809.6 8918.7 4.9 69.8%
mp5_regen mana 1809.6 154339.5 85.3 61.5%
replenishment mana 1809.6 8891.4 4.9 69.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.4sec 106.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.9sec 120.9sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 180.3 0.0 2.5sec 2.5sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_succubus 3.3 0.0 121.6sec 121.6sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.7sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.4 43.2 213.4sec 10.1sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 47.9sec 47.9sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.1 167.4 396.5sec 2.6sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 15.2 1.5 28.2sec 25.6sec 12% 10%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.8sec 46.8sec 0% 60%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 88.4sec 79.7sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.8sec 363.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.4sec
shadow_trance 16.7 25.6sec

Statistics & Data Analysis

DPS
Population
Convergence 68.33%
σ of the average dps 5.2266
2 * σ / μ 0.0391%
95% Confidence Intervall ( μ ± 2σ ) ( 26693.02 - 26713.93 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26687.80 - 26719.16 )
Sample Data
σ 522.6550
Minimum 25051.59
Maximum 28804.02
Spread ( max - min ) 3752.43
Range ( max - min ) / 2 1876.22
Range% 7.03
10th Percentile 25941.40
90th Percentile 27236.35
( 90th Percentile - 10th Percentile ) 1294.94
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1532
0.1 scale factor error with delta=300 2428
0.05 scale factor error with delta=300 9712
0.01 scale factor error with delta=300 242816
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 corruption,if=(!ticking|remains<tick_time)&miss_react
9 unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
A bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
B haunt
C fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
D summon_infernal
E drain_soul,interrupt=1,if=target.health_pct<=25
F shadowflame
G life_tap,mana_percentage<=35
H soulburn
I soul_fire,if=buff.soulburn.up
J demon_soul
K shadow_bolt
L life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
M fel_flame,moving=1
N life_tap

Sample Sequence

012346789ABDFHIJKKKKBK9KKFKKBKKKKK9BFGKKKKKBKK9FKKBGHIKK9FBKKAKKBK9FKKKBKK9FGKBKKKK9BFHIGKKKBK9FKKK6BKKA9FJKBKKKKK9BFGKKKKBKK9FKBKKKK9BFGKKKBKK9FAKBKGKK9FBKKKKKBKF9KKKBKKFGK9BKKKKFKBK69GKKABFJKKKKK9BKFKKKKB9GKKFKBKKKK9BFKGKKCBKKFK9KABKKKKFKBK9KKKGBFKKKK9BKKFKKBKK9KFGBKKK6K9BFAKJKKKBGKF9KKBKKKF9BKKKKBFGK9EBEBEAEB7EBEBEBEBE6EABEBEBEBEBE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 7977 6289 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 149490 125956 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 1
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 0
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Affliction_T11_372
origin="http://chardev.org/?profile=36750"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
glyphs=life_tap/shadow_bolt/corruption/lash_of_pain/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_infernal
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/life_tap,mana_percentage<=35
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Demonology_T11_372 : 27022dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27021.8 13.37 / 0.05% 16.6 1624.1 1546.1 mana 0.00% 42.7
Origin http://chardev.org/?profile=36757
Talents http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • immolate
  • lash_of_pain
  • metamorphosis

Charts

http://8.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:83307|69389|31446|23710|20822|16680|13367|12122|10181|7033|1329|513&chds=0,166613&chco=9482C9,C41F3B,9482C9,435133,9482C9,435133,C41F3B,C41F3B,9482C9,9482C9,C79C6E,C79C6E&chm=t++83307++bane_of_doom,9482C9,0,0,15|t++69389++immolation_aura,C41F3B,1,0,15|t++31446++corruption,9482C9,2,0,15|t++23710++fel_flame,435133,3,0,15|t++20822++shadowflame,9482C9,4,0,15|t++16680++hand_of_guldan,435133,5,0,15|t++13367++incinerate,C41F3B,6,0,15|t++12122++soul_fire,C41F3B,7,0,15|t++10181++shadow_bolt,9482C9,8,0,15|t++7033++lash_of_pain,9482C9,9,0,15|t++1329++infernal_melee,C79C6E,10,0,15|t++513++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_Demonology_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:26,17,11,7,7,6,6,6,4,3,2,2,1,1,1,0,0&chds=0,100&chco=9482C9,9482C9,C41F3B,9482C9,C41F3B,9482C9,435133,C41F3B,C41F3B,C41F3B,435133,C79C6E,C79C6E,9482C9,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|shadow_bolt|immolate|corruption|soul_fire|bane_of_doom|hand_of_guldan|shadowflame_dot|incinerate|immolation_aura|fel_flame|ebon_imp_melee|infernal_melee|shadowflame|infernal_immolation|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Demonology_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77766662zyzyzzzzzxyyyyyyyyyyywwwwwwwwwwwwwvvvvvwwxyxyzzzzyz00zzzzzzzzzzyyyyyyyyyyxxxwwwwwxwwvvvvvvvvwwwxxxxxxxwwwwwxwxxxxwvvvvvvuuuuuuuuutttttuuuvvvvvvwwxxxxxxxyxxxxxxwwwwwwwwwwvvvvvuuuuuuuuuuvvvwwwwxxxwwwwwwwwxxwwwwwwvwwwwwwwwwwwvvvwwwxxxyyyyyxxyyyyyxxxxxwwwwwwwvwwvvvvvvvvuuvvvvvvvvvwvwwwwxxxxxxxxxwwwwwvvvvvvvvvvvvvuuuuuuuuuuuvvvvvvvwvvwwwwwwwwwwvvvvvvvvvuvuuuuttttttttssssssssttttttttttttttsssstsssssssrsrrrrrrqqrqqrqqqqqqqqqqqqqqqqqqqqqqqqqqqpppp&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=104721&chtt=Warlock_Demonology_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:stuwwy1113245677745122200zwutspnmnmlmlmlljihhfffeeefggggfeedddddcbcccbbbZYYYYYYYYZZaZZZZZZaabbbcdfffggffffffggghhhhggfeeeeddddddeeedcbbbbbbccbdddddccbbbbbbbbbcbbbaZYYYYYYYYZaaaaZZYYYZZaaabbccddcccccddddddeeddddcccccdcdddddddddccddddddedddcccccccccbccccccbaaaaaaaaaaaaaaaaZZZaaaaabccdddcccddddcddddddccbbbbbaaabbbcbbbbbcccdddeefgggggffffffffffffeeddccbbbbbbccbbbbaaaaaaabbccddddcdddddeeeeeeeedddccccbccccccccbbbbbcccdeeefffeeeeeefffghhhggffeeefeeffffgff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27022|max=53138&chxp=1,1,51,100&chtt=Warlock_Demonology_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,8,7,7,11,9,36,63,80,144,174,226,319,354,441,486,560,587,659,601,614,619,602,562,497,433,367,341,298,212,159,128,99,79,56,43,39,20,22,9,10,4,2,3,5,1,3&chds=0,659&chbh=5&chxt=x&chxl=0:|min=24598|avg=27022|max=28888&chxp=0,1,57,100&chtt=Warlock_Demonology_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Demonology_T11_372 27022
bane_of_doom 1653 6.1% 7.7 60.79sec 97349 83307 0 0 0 0.0% 0.1% 0.0% 0.0% 29 20213 41692 25.1% 0.0% 96.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.68 7.68 29.20 29.20 1.1686 15.0000 747656
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.91% 0.00 0 0 0
miss 0.0 0.09% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.9 74.89% 20213.40 14595 33459 442037
crit 7.3 25.11% 41691.53 29990 68754 305620

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 1957 7.2% 24.2 18.69sec 36544 31446 0 0 0 0.0% 0.1% 0.0% 0.0% 197 3540 7356 25.1% 0.0% 99.0%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.22 24.22 196.74 196.74 1.1621 2.2755 885087
Direct Results Count Pct Average Min Max Total Damage
hit 24.2 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 147.3 74.88% 3540.10 2574 6407 521529
crit 49.4 25.12% 7356.10 5289 13165 363558

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 97 0.4% 10.1 46.63sec 4332 0 3773 5857 8485 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.15 10.15 0.00 0.00 0.0000 0.0000 43961
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.86% 3772.53 3052 5492 27893
crit 2.7 27.03% 5857.38 4715 8485 16068
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 476 1.8% 7.8 35.70sec 27674 23710 21928 45525 82686 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.77 7.76 0.00 0.00 1.1672 0.0000 215091
Direct Results Count Pct Average Min Max Total Damage
hit 5.8 75.18% 21927.50 16138 40239 127855
crit 1.9 24.71% 45525.35 33162 82686 87236
miss 0.0 0.12% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
hand_of_guldan 1640 6.1% 31.3 14.49sec 23698 16680 18686 38727 69296 25.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.29 31.27 0.00 0.00 1.4207 0.0000 741495
Direct Results Count Pct Average Min Max Total Damage
hit 23.4 74.69% 18685.98 13933 33723 436489
crit 7.9 25.18% 38727.48 28630 69296 305006
miss 0.0 0.13% 0.00 0 0 0

Action details: hand_of_guldan

Static Values
  • id:71521
  • school:shadowflame
  • resource:mana
  • tree:demonology
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a falling meteor down upon the enemy target, dealing $71521s1 Shadow damage and erupts an aura of magic within $86000a1 yards, causing all targets within it to have a $86000s1% increased chance to be critically hit by any Warlock demons. The aura lasts for $86041d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.968000
  • base_dd_min:1405.76
  • base_dd_max:1660.24
immolate 2860 10.6% 1.0 225.41sec 1247190 1232442 8499 17491 20409 28.0% 0.1% 0.0% 0.0% 196 5151 10713 25.1% 0.0% 99.1%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.04 1.04 195.75 195.75 1.0120 2.2891 1293211
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.90% 8498.85 4297 9932 6336
crit 0.3 28.00% 17491.37 8830 20409 5078
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 146.6 74.88% 5151.05 3781 8907 755035
crit 49.2 25.12% 10712.54 7769 18302 526763

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
immolation_aura 746 2.8% 5.0 95.33sec 67496 69389 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3381 0 0.0% 0.1% 0.0%

Stats details: immolation_aura

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.00 5.00 0.00 99.84 0.9727 0.0000 337142
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 99.7 99.89% 3380.81 2914 4272 337142
miss 0.1 0.11% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:50590
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites the area surrounds you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.100000
  • base_dd_min:566.82
  • base_dd_max:566.82

Action details: immolation_aura

Static Values
  • id:50589
  • school:fire
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:13153.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damaging all nearby enemies.
  • description:Ignites the area surrounding you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 1170 4.3% 31.7 12.38sec 16703 13367 13252 27490 49892 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.67 31.52 0.00 0.00 1.2496 0.0000 529012
Direct Results Count Pct Average Min Max Total Damage
hit 23.6 74.99% 13252.13 8381 24280 313274
crit 7.8 24.90% 27489.60 17222 49892 215738
miss 0.0 0.11% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
infernal_awakening 72 0.3% 1.0 0.00sec 32452 0 24834 51054 51815 29.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 32452
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 70.75% 24833.96 20787 25216 17570
crit 0.3 29.15% 51053.93 42715 51815 14882
miss 0.0 0.10% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
metamorphosis 0 0.0% 5.0 95.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.00 5.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0

Action details: metamorphosis

Static Values
  • id:47241
  • school:physical
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • description:You transform into a Demon for $47241d. This form increases your armor contribution from items by $47241s2%, damage by $47241s3%, reduces the chance you'll be critically hit by melee attacks by $54879s1% and reduces the duration of stun and snare effects by $54817s1%. You gain some unique demon abilities in addition to your normal abilities.
shadow_bolt 4572 16.9% 104.7 3.20sec 19747 10181 15583 32380 63585 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
104.70 104.70 0.00 0.00 1.9396 0.0000 2067423
Direct Results Count Pct Average Min Max Total Damage
hit 78.5 74.99% 15583.29 11282 30944 1223533
crit 26.1 24.89% 32379.72 23183 63585 843890
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1860 6.9% 34.6 13.17sec 24343 20822 2821 5848 9435 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.56 34.56 0.00 0.00 1.1691 0.0000 123594
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 74.82% 2821.06 2171 4592 72936
crit 8.7 25.07% 5848.09 4461 9435 50659
miss 0.0 0.11% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1587 5.9% 34.6 13.17sec 20766 0 0 0 0 25.0% 0.1% 0.0% 0.0% 140 4038 8400 25.1% 0.0% 47.4%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.56 34.56 139.82 139.82 0.0000 1.5334 717592
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 74.87% 0.00 0 0 0
crit 8.6 25.02% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.7 74.91% 4038.30 2919 7272 422978
crit 35.1 25.09% 8399.71 5998 14942 294614

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1857 6.9% 48.3 9.38sec 17380 12122 13895 28833 50710 25.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.33 47.54 0.00 0.00 1.4337 0.0000 839983
Direct Results Count Pct Average Min Max Total Damage
hit 35.4 74.52% 13894.86 10934 24678 492288
crit 12.1 25.37% 28832.83 22468 50710 347695
miss 0.1 0.11% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - succubus 7056
lash_of_pain 7056 100.0% 301.2 1.51sec 10585 7033 7819 15694 23202 36.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.17 301.17 0.00 0.00 1.5051 0.0000 3187901
Direct Results Count Pct Average Min Max Total Damage
hit 189.3 62.87% 7819.46 6893 11630 1480570
crit 108.8 36.12% 15693.61 13752 23202 1707331
miss 3.0 1.01% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 3436
infernal_immolation 1100 32.0% 1.0 0.00sec 81232 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2564 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 32.00 0.0000 0.0000 81232
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.7 99.00% 2564.25 2215 3830 81232
miss 0.3 1.00% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2336 68.0% 84.0 0.76sec 2054 1329 2111 4285 5478 17.2% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
84.00 84.00 0.00 0.00 1.5458 0.0000 172530
Direct Results Count Pct Average Min Max Total Damage
hit 37.1 44.23% 2110.82 1948 2739 78416
crit 14.5 17.24% 4284.73 3895 5478 62049
glance 20.2 24.00% 1590.41 1461 2054 32065
dodge 5.5 6.56% 0.00 0 0 0
miss 6.7 7.97% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 465
ebon_imp_melee 465 100.0% 258.1 0.79sec 793 513 822 1644 1644 17.0% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
258.14 258.14 0.00 0.00 1.5458 0.0000 204650
Direct Results Count Pct Average Min Max Total Damage
hit 114.9 44.52% 822.05 822 822 94466
crit 43.8 16.96% 1644.11 1644 1644 71963
glance 62.0 24.02% 616.54 617 617 38222
dodge 16.7 6.48% 0.00 0 0 0
miss 20.7 8.03% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Demonology_T11_372
bane_of_doom mana 3.2% 31.6 3082
corruption mana 4.1% 29.6 1233
demon_soul mana 1.4% 0.0 3082
fel_flame mana 1.3% 22.4 1233
hand_of_guldan mana 6.1% 16.5 1438
immolate mana 0.2% 758.6 1644
immolation_aura mana 7.2% 6.4 10520
incinerate mana 12.4% 5.8 2877
infernal mana 2.2% 0.0 16442
shadow_bolt mana 24.9% 11.3 1746
shadowflame mana 24.2% 4.7 5138
soul_fire mana 12.2% 9.4 1849
soulburn soul_shards 100.0% 0.0 1
pet - succubus
lash_of_pain mana 100.0% 18.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29097.2 16.1 1.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 0.9 24292.7 28054.8 0.0%
mana_feed mana 108.8 496450.3 4563.3 2.2%
mp5_regen mana 1809.6 91665.8 50.7 1.4%
replenishment mana 1809.6 51856.4 28.7 1.3%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_feed mana 0.9 84.3 97.4 99.4%
mana_spring_totem mana 1809.6 8885.1 4.9 69.9%
mp5_regen mana 1809.6 154339.5 85.3 61.6%
replenishment mana 1809.6 8842.5 4.9 69.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.6sec 104.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 215.9 0.0 2.1sec 2.1sec 77% 77%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
decimation 1.0 53.3 62.3sec 2.1sec 24% 94%

Database details

  • id:63167
  • cooldown name:buff_decimation
  • tooltip:Your Soul Fire cast time is reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
demon_soul_succubus 3.3 0.0 122.0sec 122.0sec 14% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
hand_of_guldan 8.8 22.5 49.4sec 14.5sec 97% 97%

Database details

  • id:
  • cooldown name:buff_hand_of_guldan
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
metamorphosis 5.0 0.0 95.3sec 95.3sec 39% 68%

Database details

  • id:47241
  • cooldown name:buff_metamorphosis
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • max_stacks:1
  • duration:36.00
  • cooldown:0.00
  • default_chance:100.00%
molten_core 10.2 1.5 41.3sec 35.4sec 16% 100%

Database details

  • id:71165
  • cooldown name:buff_molten_core
  • tooltip:Increases damage done by $71165s1% and reduces cast time by $71165s3% of your Incinerate.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:6.00%
power_torrent_mh 9.9 0.0 47.8sec 47.8sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 46.6sec 46.6sec 0% 6%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.9 0.1 83.3sec 81.8sec 2% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.2sec 363.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 14.6 29.3sec
impending_doom 25.2 16.1sec

Statistics & Data Analysis

DPS
Population
Convergence 56.56%
σ of the average dps 6.6865
2 * σ / μ 0.0495%
95% Confidence Intervall ( μ ± 2σ ) ( 27008.38 - 27035.12 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27001.69 - 27041.81 )
Sample Data
σ 668.6457
Minimum 24598.36
Maximum 28887.55
Spread ( max - min ) 4289.19
Range ( max - min ) / 2 2144.59
Range% 7.94
10th Percentile 25950.91
90th Percentile 27311.04
( 90th Percentile - 10th Percentile ) 1360.14
Approx. Iterations needed for
1% dps error 24
0.1% dps error 2449
0.1 scale factor error with delta=300 3974
0.05 scale factor error with delta=300 15896
0.01 scale factor error with delta=300 397410
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 metamorphosis
9 immolation,if=buff.metamorphosis.remains>10
A bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
B immolate,if=!ticking&target.time_to_die>=4&miss_react
C corruption,if=(remains<tick_time|!ticking)&target.time_to_die>=6&miss_react
D fel_flame,if=buff.tier11_4pc_caster.react
E shadowflame
F hand_of_guldan
G incinerate,if=buff.molten_core.react
H soulburn
I soul_fire,if=buff.decimation.react|buff.soulburn.up
J summon_infernal
K life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
L demon_soul
M shadow_bolt
N life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
O fel_flame,moving=1
P life_tap

Sample Sequence

012346789ABCEFHIJLMGGGMMMEFCGGGMMMMEMFMMMCMMEMFMMHIMMCEMFAMMMMEMCFMMMGEGGKFMMCDDEHIMMF89MMECMMMF6MAEMMLMCMFMEMMMMGFCEGGGMMDDFEMMCMGGGEFMG89AGGCEMFMMMMEMMCFGGGMEMMGFGGCMEMMMFMGG6EGACMMFLMEMMMMCFMDDEMMMMFMCEKM89MMFMEMMCMAMFEMMMGGCGEFMMMMMEMFCGGGMMEMFMMMCM6EMAFGGG89LMECMMFMMMEMMMCFMMEMMMMFDCDEIIIIIAFIEIICIII7IFEIIIIIGCGEFGIIIIIIEIFC89IIIIEII6FIAIICEIIIFIIIIEIICIFIIIEIIIIGFGCEGIIIIIFIEIII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8438 6652 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 155860 131038 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 27.20% 17.62% 2256
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 17.62% 17.62% 2256
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.87% 13.87% 1053

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 0
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 3
Dark Arts 3
Fel Synergy 2
Demonic Rebirth 2
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 3
Demonic Empowerment 1
Improved Health Funnel 0
Molten Core 3
Hand of Gul'dan 1
Aura of Foreboding 2
Ancient Grimoire 2
Inferno 1
Decimation 2
Cremation 2
Demonic Pact 1
Metamorphosis 1
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Demonology_T11_372
origin="http://chardev.org/?profile=36757"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
glyphs=life_tap/shadow_bolt/immolate/lash_of_pain/metamorphosis
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/metamorphosis
actions+=/immolation,if=buff.metamorphosis.remains>10
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/immolate,if=!ticking&target.time_to_die>=4&miss_react
actions+=/corruption,if=(remains=6&miss_react
actions+=/fel_flame,if=buff.tier11_4pc_caster.react
actions+=/shadowflame
actions+=/hand_of_guldan
actions+=/incinerate,if=buff.molten_core.react
actions+=/soulburn
actions+=/soul_fire,if=buff.decimation.react|buff.soulburn.up
actions+=/summon_infernal
actions+=/life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2256
# gear_mastery_rating=1053
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Destruction_T11_372 : 27660dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27659.8 9.49 / 0.03% 13.1 2117.0 2002.0 mana 0.00% 49.0
Origin http://chardev.org/?profile=36761
Talents http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
Glyphs
  • life_tap
  • immolate
  • imp
  • conflagrate

Charts

http://9.chart.apis.google.com/chart?chs=550x420&cht=bhg&chf=bg,s,333333&chd=t:63611|55129|27666|26926|26362|22276|17039|16042|13448|10873|4693|1384|523&chds=0,127223&chco=9482C9,C41F3B,C41F3B,435133,9482C9,9482C9,C41F3B,9482C9,C41F3B,C41F3B,C41F3B,C79C6E,C79C6E&chm=t++63611++bane_of_doom,9482C9,0,0,15|t++55129++immolate,C41F3B,1,0,15|t++27666++conflagrate,C41F3B,2,0,15|t++26926++fel_flame,435133,3,0,15|t++26362++corruption,9482C9,4,0,15|t++22276++shadowflame,9482C9,5,0,15|t++17039++chaos_bolt,C41F3B,6,0,15|t++16042++shadowburn,9482C9,7,0,15|t++13448++incinerate,C41F3B,8,0,15|t++10873++soul_fire,C41F3B,9,0,15|t++4693++firebolt,C41F3B,10,0,15|t++1384++infernal_melee,C79C6E,11,0,15|t++523++ebon_imp_melee,C79C6E,12,0,15&chtt=Warlock_Destruction_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:17,17,14,13,7,6,6,5,5,4,2,1,1,1,1,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,9482C9,C41F3B,C41F3B,9482C9,435133,C79C6E,9482C9,9482C9,C79C6E,C41F3B,C41F3B,C41F3B&chl=firebolt|incinerate|immolate|conflagrate|soul_fire|shadowflame_dot|corruption|burning_embers|chaos_bolt|bane_of_doom|fel_flame|infernal_melee|shadowburn|shadowflame|ebon_imp_melee|infernal_immolation|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Destruction_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s8644333xyzy000zzywwvuvvwwxxvvtssrqqpppqqqstrqqppppprrrrsrrrrrrqppqqrrrpooooooooooooonmnoonnnnnnnnmnnnnooooooonnnnnmmnmmnmlkkjiihhhhijjkjjjjiihhhhijjjjjjjjjjiijiiiiiihhhgggggggggfffffeeeddddddeeeeefffffeeeedddddddddddcccbbbbbbbbbbbbaaaaaaaaaaaaZaZZZZYZYYZZYYYYYXXXXXXXXXXXXWWWWVVVVWWWWWWXXXXXXXXXXWWWWWWWWWWWWVVVVVVUUVUUVVVVVVVVVVVVWWWWWXXXXXXXXXXXXXXWWWWWWWWWWWWVVVUUUUUTTUUUUVVWWWWXWWWWWWVWWWWWWWWWWWWWWVVVVVVVVVVWWWWWWXXXXXXYYYYYYYYYYYZZZZZYYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105785&chtt=Warlock_Destruction_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:fmnnoqssvyx0212456775410100zyvrrqppppoonnmnnmnmkkjijjkllkjjhhhhhgffeffgggfcccdeeeedddeeeffeeeefgghhhhiiiiiiiiiiijjklkkjiiiijjjjiijjklkkjiiijkjjjjjjkkjjiihhhgggggggffeeedddddddeeeeedddddeeefffgghhhgfffggggghhhhhhhggggggghhiiiiiiiiiiiiiiijkkkkjjjjjjjjjjiiiiiihhgggggffffffffeeeeefffgghhhhhhhhhggggggggggffeeeedddeeeffgghhhhiijjkkklllmmmlllkkjjjjjiihhgggfffeeefffgggggggghhiijjkklllkkkjjjjjjjiiihhgggfffeeeefffggggghhhiiijjkklllllllllllkkkkkjjiihhhhhhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27660|max=47745&chxp=1,1,58,100&chtt=Warlock_Destruction_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,4,5,10,9,22,34,55,61,93,126,184,187,240,293,321,409,470,531,534,597,549,553,537,524,524,485,445,362,347,304,228,192,156,142,111,87,61,56,46,36,16,18,15,4,3,3,4,2&chds=0,597&chbh=5&chxt=x&chxl=0:|min=25989|avg=27660|max=29235&chxp=0,1,51,100&chtt=Warlock_Destruction_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Destruction_T11_372 27660
bane_of_doom 1236 4.5% 7.7 60.11sec 72408 63611 0 0 0 0.0% 1.5% 0.0% 0.0% 29 15240 31577 25.1% 0.0% 95.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.72 7.72 28.92 28.92 1.1383 15.0000 559209
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.48% 0.00 0 0 0
miss 0.1 1.52% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.7 74.94% 15239.96 12416 21522 330364
crit 7.2 25.06% 31577.40 25514 44225 228845

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
burning_embers 1399 5.1% 331.0 1.36sec 1913 0 0 0 0 24.7% 1.5% 0.0% 0.0% 448 1413 0 0.0% 0.0% 99.1%

Stats details: burning_embers

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
330.96 330.96 448.04 448.04 0.0000 1.0000 632977
Direct Results Count Pct Average Min Max Total Damage
hit 244.2 73.80% 0.00 0 0 0
crit 81.7 24.68% 0.00 0 0 0
miss 5.1 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 448.0 100.00% 1412.77 260 2158 632977

Action details: burning_embers

Static Values
  • id:85421
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:Your Soulfire and your Imp's Firebolt cause a Burning Ember damage-over-time effect on the target equal to a percentage of the damage done lasting $85421d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1555.18
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
chaos_bolt 1373 5.0% 31.1 14.56sec 19973 17039 15313 32163 45463 29.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.10 30.95 0.00 0.00 1.1722 0.0000 621147
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 68.89% 15312.93 12102 21370 326544
crit 9.2 29.59% 32162.67 26360 45463 294604
miss 0.5 1.52% 0.00 0 0 0

Action details: chaos_bolt

Static Values
  • id:50796
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a bolt of chaotic fire at the enemy, dealing $s1 Fire damage. Chaos Bolt cannot be resisted, and pierces through all absorption effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1311.57
  • base_dd_max:1665.89
conflagrate 3632 13.1% 51.9 8.76sec 31653 27666 22599 46521 75123 39.3% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.90 51.90 0.00 0.00 1.1441 0.0000 1642771
Direct Results Count Pct Average Min Max Total Damage
hit 30.7 59.08% 22598.67 18565 36559 692918
crit 20.4 39.34% 46521.48 38149 75123 949852
miss 0.8 1.58% 0.00 0 0 0

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3288.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly deals fire damage equal to $s2% of your Immolate's periodic damage on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:10510.96
  • base_dd_max:10510.96
corruption 1678 6.1% 25.2 18.12sec 30083 26362 0 0 0 0.0% 1.5% 0.0% 0.0% 199 2999 6218 25.1% 0.0% 98.3%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.23 25.23 199.42 199.42 1.1412 2.2299 759019
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 98.47% 0.00 0 0 0
miss 0.4 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 149.4 74.93% 2999.13 2430 4426 448169
crit 50.0 25.07% 6218.17 4994 9094 310850

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 109 0.4% 10.3 45.95sec 4798 0 4244 6564 7585 26.7% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.27 10.27 0.00 0.00 0.0000 0.0000 49277
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 71.70% 4243.82 3817 5023 31250
crit 2.7 26.74% 6564.06 5898 7585 18027
miss 0.2 1.56% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.32 4.32 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 505 1.8% 7.4 38.09sec 30781 26926 24687 51144 75581 24.8% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.42 7.40 0.00 0.00 1.1432 0.0000 228315
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 73.67% 24686.72 20162 36782 134599
crit 1.8 24.76% 51143.65 41429 75581 93716
miss 0.1 1.58% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
immolate 3837 13.9% 26.9 16.95sec 64547 55129 6368 13331 18658 30.8% 1.5% 0.0% 0.0% 199 5635 11831 31.1% 0.0% 98.8%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.88 26.88 199.50 199.50 1.1708 2.2404 1735331
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 67.70% 6367.69 5371 9080 115904
crit 8.3 30.75% 13330.96 11036 18658 110211
miss 0.4 1.55% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 137.4 68.85% 5634.99 4725 8142 774000
crit 62.1 31.15% 11830.92 9709 16731 735216

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 4639 16.8% 119.9 3.69sec 17506 13448 13378 28315 40968 29.5% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
119.87 119.33 0.00 0.00 1.3017 0.0000 2098372
Direct Results Count Pct Average Min Max Total Damage
hit 82.3 68.97% 13378.01 11100 19937 1101043
crit 35.2 29.52% 28314.71 22808 40968 997329
miss 1.8 1.51% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
infernal_awakening 60 0.2% 1.0 0.00sec 27167 0 20933 43027 47362 29.6% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 27167
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 69.00% 20932.86 15922 21342 14444
crit 0.3 29.57% 43026.87 32717 47362 12723
miss 0.0 1.43% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
shadowburn 222 0.8% 5.4 17.52sec 18623 16042 14859 30800 42940 25.0% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.39 5.39 0.00 0.00 1.1609 0.0000 100319
Direct Results Count Pct Average Min Max Total Damage
hit 4.0 73.44% 14858.67 11833 20897 58785
crit 1.3 25.03% 30799.69 24316 42940 41533
miss 0.1 1.52% 0.00 0 0 0

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly blasts the target for $17877s2 Shadow damage. If the target dies within $29341d of Shadowburn, and yields experience or honor, the caster gains $29341s1 Soul Shards. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.056000
  • base_dd_min:649.32
  • base_dd_max:724.90
shadowflame 1899 6.9% 33.7 13.48sec 25509 22276 2163 4468 5874 24.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.68 33.68 0.00 0.00 1.1451 0.0000 90838
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 73.85% 2162.73 1848 2780 53787
crit 8.3 24.62% 4468.16 3797 5874 37051
miss 0.5 1.53% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1698 6.1% 33.7 13.48sec 22812 0 0 0 0 24.8% 1.5% 0.0% 0.0% 134 4502 9339 25.1% 0.0% 44.5%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.68 33.68 134.40 134.40 0.0000 1.4989 768219
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 73.70% 0.00 0 0 0
crit 8.3 24.76% 0.00 0 0 0
miss 0.5 1.54% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.7 74.90% 4501.79 3647 6647 453212
crit 33.7 25.10% 9338.99 7494 13658 315007

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1809 6.5% 39.1 11.44sec 20920 10873 16021 33518 46363 29.8% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.11 38.97 0.00 0.00 1.9240 0.0000 818279
Direct Results Count Pct Average Min Max Total Damage
hit 26.8 68.66% 16020.84 13668 22563 428692
crit 11.6 29.82% 33518.03 28085 46363 389587
miss 0.6 1.52% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 45.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - imp 4690
firebolt 4690 100.0% 300.2 1.51sec 7064 4693 5698 11475 17135 26.3% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
300.20 298.54 0.00 0.00 1.5051 0.0000 2120552
Direct Results Count Pct Average Min Max Total Damage
hit 214.1 71.71% 5697.77 4983 8589 1219818
crit 78.5 26.29% 11475.25 9942 17135 900735
miss 6.0 2.00% 0.00 0 0 0

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:632.0
  • cooldown:0.00
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $ Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.649000
  • base_dd_min:111.86
  • base_dd_max:124.88
pet - infernal 3350
infernal_immolation 1069 31.9% 1.0 0.00sec 56901 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2639 0 0.0% 2.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0000 0.0000 56901
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.6 98.02% 2638.69 2209 3825 56901
miss 0.4 1.98% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 2281 68.1% 58.0 0.74sec 2093 1384 2147 4380 5472 17.2% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 1.5120 0.0000 121415
Direct Results Count Pct Average Min Max Total Damage
hit 25.7 44.25% 2146.71 1945 2736 55098
crit 10.0 17.25% 4379.86 3890 5472 43809
glance 13.9 23.97% 1618.93 1459 2052 22508
dodge 3.8 6.50% 0.00 0 0 0
miss 4.7 8.03% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 203
ebon_imp_melee 203 100.0% 102.1 0.77sec 791 523 822 1644 1644 16.8% 14.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.14 102.14 0.00 0.00 1.5120 0.0000 80834
Direct Results Count Pct Average Min Max Total Damage
hit 45.5 44.60% 822.05 822 822 37443
crit 17.2 16.84% 1644.11 1644 1644 28278
glance 24.5 24.00% 616.54 617 617 15113
dodge 6.7 6.53% 0.00 0 0 0
miss 8.2 8.04% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Destruction_T11_372
bane_of_doom mana 2.5% 23.5 3082
chaos_bolt mana 4.7% 13.9 1438
conflagrate mana 17.8% 9.6 3288
corruption mana 3.2% 24.4 1233
demon_soul mana 1.1% 0.0 2368
fel_flame mana 1.0% 25.0 1233
immolate mana 4.6% 39.3 1644
incinerate mana 36.0% 6.1 2877
infernal mana 1.7% 0.0 16442
shadowburn mana 1.7% 6.0 3082
shadowflame mana 18.1% 5.0 5138
soul_fire mana 7.6% 11.3 1849
soulburn soul_shards 100.0% 0.0 1
pet - imp
firebolt mana 100.0% 11.2 632
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.6 29402.3 16.2 0.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 99788.0 99788.0 0.0%
life_tap mana 0.6 16518.4 27480.2 0.0%
mana_feed mana 78.5 365104.4 4651.4 0.2%
mp5_regen mana 1809.6 92614.8 51.2 0.3%
replenishment mana 1809.6 52259.4 28.9 0.3%
soul_leech mana 74.2 343780.3 4635.0 0.2%
pet - imp mana
initial_mana none 1.0 74772.5 74772.5 0.0%
mana_feed mana 0.6 66.9 111.3 99.3%
mana_spring_totem mana 1809.6 8156.8 4.5 72.4%
mp5_regen mana 1809.6 171595.1 94.8 65.7%
replenishment mana 1809.6 9790.8 5.4 72.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 33.7 17.3 13.5sec 8.9sec 81% 84%

Database details

  • id:54277
  • cooldown name:buff_backdraft
  • tooltip:Reduced cast time for your Shadow Bolt, Incinerate and Chaos Bolt by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bell_of_enraging_resonance 4.8 0.0 103.8sec 103.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 205.8 0.0 2.2sec 2.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.3 0.0 45.9sec 45.9sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_imp 4.3 0.0 120.7sec 120.7sec 19% 17%

Database details

  • id:79459
  • cooldown name:buff_demon_soul_imp
  • tooltip:Critical strike chance of your cast time Destruction spells increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
empowered_imp 11.4 0.4 36.1sec 34.9sec 5% 7%

Database details

  • id:47283
  • cooldown name:buff_empowered_imp
  • tooltip:Soulfire is instant cast.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:4.00%
improved_soul_fire 7.3 31.1 60.7sec 11.6sec 95% 94%

Database details

  • id:85383
  • cooldown name:buff_improved_soul_fire
  • tooltip:Shadow and Fire damage increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.6sec 46.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 45.7sec 45.7sec 0% 2%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.2 87.1sec 81.5sec 6% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.3sec 363.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
imp-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
imp-casting 301.2 0.0 1.5sec 1.5sec 95% 95%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 15.5%
backdraft_1 21.8%
backdraft_2 29.6%
backdraft_3 33.1%

Procs

Count Interval
ebon_imp 5.8 64.0sec
empowered_imp 11.8 34.9sec

Statistics & Data Analysis

DPS
Population
Convergence 67.51%
σ of the average dps 4.7455
2 * σ / μ 0.0343%
95% Confidence Intervall ( μ ± 2σ ) ( 27650.32 - 27669.30 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27645.57 - 27674.05 )
Sample Data
σ 474.5501
Minimum 25989.34
Maximum 29235.44
Spread ( max - min ) 3246.09
Range ( max - min ) / 2 1623.05
Range% 5.87
10th Percentile 26953.95
90th Percentile 28117.52
( 90th Percentile - 10th Percentile ) 1163.57
Approx. Iterations needed for
1% dps error 11
0.1% dps error 1177
0.1 scale factor error with delta=300 2001
0.05 scale factor error with delta=300 8007
0.01 scale factor error with delta=300 200175
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_imp
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 soulburn,if=buff.bloodlust.down
A soul_fire,if=buff.soulburn.up
B fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
C immolate,if=(remains<cast_time+gcd|!ticking)&target.time_to_die>=4&miss_react
D conflagrate
E bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
F corruption,if=(!ticking|dot.corruption.remains<tick_time)&miss_react
G shadowflame
H soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
I chaos_bolt
J summon_infernal
K soulburn,if=buff.bloodlust.down
L soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
M shadowburn
N incinerate
O life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
P fel_flame,moving=1
Q life_tap

Sample Sequence

01234678CDEFGIJLNDNNNCNGNDFILNNNDCGNNNNIDLF9ANCGDHNINNNDFGLCNDEINNNGDLFCNIDNNGN9ALDNCFINGDNLBNNDBIGFNLDNCNN68GIDELFN9ADCGNINNDLNNFGCDIHNNNNDGNLCFDINNNGBDLBNIFDEGNNCLDQINNGNDFLCNIDGNNNNHDFNCGINDLNNNNDFC68GHINDENBHNNBDGFINLDCNNNGNDILFNNCDGNNILDNNNFGCDILNNNDEGHNCFDINNNGLDNNNCFILDGNNNNNCHDIFNGNNQDL68CINGDHFENNNDINBBGLDNHCFINDGNNLNQDCIFGNNDLNNIDCGHNFNDNNEILCD7GMNNFNDILNGCDMNNNIFDGLNCNDMNINGLDF68NNCNIDGLEMNDFNCIGLDNNMNNNDCFGILDMNNNNGCDFILNMDNGN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5731 5049 4639
Spirit 203 203 20
Health 152668 128504 0
Mana 105638 96008 0
Spell Power 9423 7246 2207
Spell Hit 15.47% 15.47% 1585
Spell Crit 20.66% 14.61% 919
Spell Haste 30.05% 20.25% 2593
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 13.20% 13.20% 1585
Melee Crit 16.14% 8.19% 919
Melee Haste 20.25% 20.25% 2593
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.97% 12.97% 891

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 3
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 2
Backdraft 3
Shadowburn 1
Burning Embers 2
Soul Leech 2
Backlash 0
Nether Ward 1
Fire and Brimstone 3
Shadowfury 1
Nether Protection 2
Empowered Imp 2
Bane of Havoc 1
Chaos Bolt 1

Profile

#!./simc

warlock=Warlock_Destruction_T11_372
origin="http://chardev.org/?profile=36761"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
glyphs=life_tap/immolate/imp/conflagrate
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_imp
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.soulburn.up
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
actions+=/immolate,if=(remains=4&miss_react
actions+=/conflagrate
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/corruption,if=(!ticking|dot.corruption.remains actions+=/shadowflame
actions+=/soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
actions+=/chaos_bolt
actions+=/summon_infernal
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
actions+=/shadowburn
actions+=/incinerate
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4639
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1585
# gear_crit_rating=919
# gear_haste_rating=2593
# gear_mastery_rating=891
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warrior_Arms_T11_372 : 27537dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27536.7 16.13 / 0.06% 2715.9 10.1 10.2 rage 7.33% 50.3
Origin http://chardev.org/?profile=36399
Talents http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
Glyphs
  • thunder_clap
  • cleaving
  • sweeping_strikes
  • battle
  • berserker_rage
  • intimidating_shout
  • slam
  • overpower
  • mortal_strike

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:32010|24863|19942|17917|16716|8911|3234&chds=0,64020&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++32010++overpower,C79C6E,0,0,15|t++24863++execute,C79C6E,1,0,15|t++19942++slam,C79C6E,2,0,15|t++17917++mortal_strike,C79C6E,3,0,15|t++16716++rend,C79C6E,4,0,15|t++8911++colossus_smash,C79C6E,5,0,15|t++3234++melee_main_hand,C79C6E,6,0,15&chtt=Warrior_Arms_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:20,19,11,10,10,8,6,6,5,4&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E&chl=overpower|mortal_strike|slam_mh|melee_main_hand|opportunity_strike|deep_wounds|execute|rend_dot|heroic_strike|colossus_smash&chtt=Warrior_Arms_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:bgbhbhmq4467875uqjlifdaeecZabZWZZaaXWYZbaZbXYXTUUUTSRSSSRSTRRVVWXWXXVXXWXXWWUVUUUTTTSTSSTSSTTUUSSSRRRRRRSRRSRRRQQRPQQPQRQRTUUVXZdgjnrtwxvspljhfedbaZYYYYXYYYXXWWVVVUUVUUUUUUTTTTSSTSSSSTUTUUTTTSSSSSSSSSSRRSRSSRRSRSSSTUUUUUTTTTTTTTTSTTTTTTTTTSTTSTTUVWXZbcfhjlmmmmkjigfedcbaZYXXXWXXWWWVVVUUUUUUUTUUTUUTTUTTTTTUUVWWWWWWVVUUTTTSSSSRSSRSSSRSSSSTSTTTTSSTTTTTSTSTTTTTTTTTTTTTTUUUVVWWXYYZZaaaaaZZZZYYYXXXWWWWXWWWWWVVVVVVUUUUUTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Warrior_Arms_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:344455765446677775124zxwwvurqrrrqppppooomllllkkjjjjihggggffeeeefffffffffffffffffffffffffffeeeffffffggggffgggggghhhiijjkkkkkllmmmnnooononnnmmmmmmlmllllllkkkkkkkkkkkkjjjiihhhgggggggfffffffffffffffffffffeeeeefffffgggggghhhhhhiiiiiiiiiiiihiiiiiiiiiijjjjjjjkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkjjjjjjiiiiihhhhhhhhhhhiiiiiijjjjjjjjkkkkkkkklllllllllllllllllllllllllkkkkkkkkkkkkkkkkllllllllmmmmmmmnnnnoooppppqqqrrrsssssssssrrrrrqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrrrrrrr&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27537|max=44242&chxp=1,1,62,100&chtt=Warrior_Arms_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,1,4,11,12,26,50,45,63,110,162,184,251,326,375,423,513,545,575,683,636,604,615,600,566,502,434,378,329,230,196,161,116,74,61,45,32,22,6,12,4,3,6,2,3,0,0,2&chds=0,683&chbh=5&chxt=x&chxl=0:|min=24527|avg=27537|max=31076&chxp=0,1,46,100&chtt=Warrior_Arms_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Arms_T11_372 27537
battle_shout 0 0.0% 5.5 76.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.48 5.48 0.00 0.00 1.5144 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 15.2 30.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.17 15.17 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
colossus_smash 1104 4.0% 37.0 12.27sec 13488 8911 11224 23616 40961 21.3% 3.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.03 37.03 0.00 0.00 1.5136 0.0000 499387
Direct Results Count Pct Average Min Max Total Damage
hit 27.9 75.34% 11224.37 8858 19884 313103
crit 7.9 21.31% 23615.62 18248 40961 186285
dodge 1.2 3.35% 0.00 0 0 0

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
deadly_calm 0 0.0% 3.5 128.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.52 3.52 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:-0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Abilities cost no rage.
  • description:For the next $d, none of your abilities cost rage, but you continue to generate rage. Cannot be used during Inner Rage.
deep_wounds 2261 8.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 430 2377 0 0.0% 0.0% 95.1%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 173.40 430.22 430.22 0.0000 1.0000 1022647
Direct Results Count Pct Average Min Max Total Damage
hit 173.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 430.2 100.00% 2377.03 755 9728 1022647

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1258.41
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1690 6.1% 20.3 4.35sec 37575 24863 31184 57873 135706 27.8% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.35 20.35 0.00 0.00 1.5112 0.0000 764461
Direct Results Count Pct Average Min Max Total Damage
hit 14.0 68.86% 31184.35 577 65877 436880
crit 5.7 27.82% 57873.40 904 135706 327581
dodge 0.7 3.32% 0.00 0 0 0

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 1494 5.4% 39.2 11.34sec 17259 0 12617 27271 48604 34.6% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.16 39.16 0.00 0.00 0.0000 0.0000 675835
Direct Results Count Pct Average Min Max Total Damage
hit 24.3 62.11% 12617.41 8205 23197 306869
crit 13.5 34.55% 27271.04 16903 48604 368966
dodge 1.3 3.34% 0.00 0 0 0

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 2786 10.1% 128.7 3.53sec 9791 3234 8885 18282 30542 18.5% 3.3% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
128.68 128.68 0.00 0.00 3.0273 0.0000 1259848
Direct Results Count Pct Average Min Max Total Damage
hit 69.6 54.08% 8885.25 6278 14826 618313
crit 23.8 18.51% 18282.33 12933 30542 435379
glance 31.0 24.07% 6657.01 4709 10843 206156
dodge 4.3 3.35% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 5304 19.3% 88.0 5.15sec 27250 17917 20118 45830 76778 30.4% 3.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.03 88.03 0.00 0.00 1.5209 0.0000 2398774
Direct Results Count Pct Average Min Max Total Damage
hit 58.3 66.28% 20117.54 12083 32894 1173802
crit 26.7 30.36% 45830.01 27454 76778 1224972
dodge 3.0 3.35% 0.00 0 0 0

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:Healing effects received reduced by $s1%.
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and wounds the target, reducing the effectiveness of any healing received by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:423.09
  • base_dd_max:423.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
opportunity_strike 2703 9.8% 127.4 3.54sec 9595 0 8010 16853 27651 21.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.39 127.39 0.00 0.00 0.0000 0.0000 1222329
Direct Results Count Pct Average Min Max Total Damage
hit 96.4 75.70% 8010.49 5790 13078 772497
crit 26.7 20.95% 16852.75 11928 27651 449832
dodge 4.3 3.34% 0.00 0 0 0

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
overpower 5530 20.1% 77.1 5.81sec 32446 32010 16045 36757 58727 79.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.08 77.08 0.00 0.00 1.0136 0.0000 2501031
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 20.82% 16045.05 8787 25848 257468
crit 61.0 79.18% 36757.47 19964 58727 2243562

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:5.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly overpower the enemy, causing $m1% weapon damage. Only useable after the target dodges. The Overpower cannot be blocked, dodged or parried.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
recklessness 0 0.0% 2.0 363.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
rend 1650 6.0% 29.4 15.46sec 25361 16716 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.43 29.43 0.00 0.00 1.5171 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 29.4 100.00% 0.00 0 0 0

Action details: rend

Static Values
  • id:772
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Wounds the target causing them to bleed for $94009o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $94009d.
rend_dot 1650 6.0% 29.4 15.46sec 25361 0 0 0 0 0.0% 3.3% 0.0% 0.0% 168 3611 7458 21.6% 0.0% 92.5%

Stats details: rend_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.43 29.43 167.97 167.97 0.0000 2.4915 746429
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 96.73% 0.00 0 0 0
dodge 1.0 3.27% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.6 78.35% 3611.17 1494 4902 475266
crit 36.4 21.65% 7458.00 3077 10099 271163

Action details: rend_dot

Static Values
  • id:94009
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:Wounds the target causing them to bleed for $o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:2094.17
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slam 3013 10.9% 45.2 7.87sec 30157 19942 0 0 0 0.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.19 45.19 0.00 0.00 1.5122 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 43.7 96.69% 0.00 0 0 0
dodge 1.5 3.31% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 3013 10.9% 43.7 8.13sec 31191 0 23815 54264 89504 24.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.69 43.69 0.00 0.00 0.0000 0.0000 1362788
Direct Results Count Pct Average Min Max Total Damage
hit 33.1 75.78% 23814.84 14805 39394 788469
crit 10.6 24.22% 54263.96 33636 89504 574319

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:-1.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Arms_T11_372
colossus_smash rage 14.7% 739.4 18
execute rage 11.5% 1444.5 26
heroic_strike rage 10.6% 1386.7 12
mortal_strike rage 35.2% 1485.9 18
overpower rage 7.7% 7040.1 5
rend rage 5.8% 2820.9 9
slam rage 13.5% 2195.1 14
Resource Gains Type Count rage Average Overflow
anger_management rage 1809.6 147.3 0.1 2.3%
avoided_attacks rage 5.7 90.5 15.8 0.0%
battle_shout rage 5.5 109.7 20.0 0.0%
berserker_rage rage 15.2 75.8 5.0 0.0%
blood_frenzy rage 12.4 235.6 19.0 5.1%
melee_main_hand rage 128.7 3877.8 30.1 2.4%
sudden_death rage 10.1 80.4 8.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 3.0 0.0 183.7sec 362.7sec 99% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 12.8 0.0 32.8sec 32.8sec 5% 6%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 15.2 0.0 30.8sec 30.8sec 33% 33%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance 2.0 0.0 365.4sec 365.4sec 1% 100%

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.3sec 123.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
colossus_smash 29.4 6.4 15.5sec 12.7sec 47% 41%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_calm 3.5 0.0 128.1sec 128.1sec 8% 7%

Database details

  • id:
  • cooldown name:buff_deadly_calm
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
executioner_talent 2.5 17.2 35.3sec 4.5sec 19% 38%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 338.5sec 338.5sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.3sec 107.3sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 3.4 0.0 103.6sec 103.6sec 2% 9%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
inner_rage 4.5 0.0 96.4sec 96.4sec 15% 15%

Database details

  • id:1134
  • cooldown name:buff_inner_rage
  • tooltip:Heroic Strike and Cleave cooldown reduced.
  • max_stacks:1
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
lambs_to_the_slaughter 1.1 84.0 246.4sec 5.3sec 100% 99%

Database details

  • id:
  • cooldown name:buff_lambs_to_the_slaughter
  • tooltip:(null)
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 14.2 25.2 31.9sec 11.3sec 65% 66%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overpower 14.9 0.6 29.1sec 28.0sec 5% 18%

Database details

  • id:
  • cooldown name:buff_overpower
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:1.00
  • default_chance:100.00%
recklessness 2.0 0.0 363.9sec 363.9sec 5% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
taste_for_blood 70.1 2.8 6.4sec 6.2sec 29% 90%

Database details

  • id:
  • cooldown name:buff_taste_for_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:9.00
  • cooldown:5.00
  • default_chance:100.00%
tier11_4pc_melee 2.0 75.1 370.7sec 5.8sec 96% 94%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
wrecking_crew 13.5 13.3 34.2sec 16.8sec 55% 54%

Database details

  • id:
  • cooldown name:buff_wrecking_crew
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 2.3%

Procs

Count Interval
munched_deep_wounds 29.6 15.5sec
rolled_deep_wounds 31.3 15.0sec
strikes_of_opportunity 127.4 3.5sec
sudden_death 36.4 12.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.69%
σ of the average dps 8.0628
2 * σ / μ 0.0586%
95% Confidence Intervall ( μ ± 2σ ) ( 27520.55 - 27552.80 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27512.49 - 27560.86 )
Sample Data
σ 806.2817
Minimum 24526.52
Maximum 31075.92
Spread ( max - min ) 6549.40
Range ( max - min ) / 2 3274.70
Range% 11.89
10th Percentile 26523.79
90th Percentile 28577.50
( 90th Percentile - 10th Percentile ) 2053.71
Approx. Iterations needed for
1% dps error 34
0.1% dps error 3429
0.1 scale factor error with delta=300 5778
0.05 scale factor error with delta=300 23114
0.01 scale factor error with delta=300 577857
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
6 stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
7 recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
8 berserker_rage,if=!buff.deadly_calm.up&rage<70
9 deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
A sweeping_strikes,if=target.adds>0
B bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
C cleave,if=target.adds>0
D inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
E heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
F overpower,if=buff.taste_for_blood.remains<=1.5
G mortal_strike,if=target.health_pct>20|rage>=30
H execute,if=buff.battle_trance.up
I rend,if=!ticking
J colossus_smash,if=buff.colossus_smash.remains<0.5
K execute,if=(buff.deadly_calm.up|buff.recklessness.up)
L mortal_strike
M overpower
N execute
O slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
P battle_shout,if=rage<20

Sample Sequence

013458P7E69GIEJGEMOJDEGMDEOMGEIJGEMOJGMO8JGIMGOMGOJGMOGIMJGEMO8PGMOGIJGMOJGMGOIGJMG8MOGMOIGEJMEGMEOGIJMGO9EMGEFOMEGIEJDGDEM8OGMOGOIGMOGEJMPFGEJIGMJ8GOMGOEFIGDEJMEGEMJFGMOIGFJDE8MGOMGOFIGEMOGMOJGMOPGIJ8MEGOMGOMGIGMJGOMGEO9IEGJEMGEMJDEGDE8MOIEGJMGEOMGFOIMGPMGEFJG8MOIGMDEOGOMGOJIGEMJGEMO8GMIGJMGEOJMGOMGEFPIGMO8GMJGMOGIGJEMGMO9EGOEIGEMOMDEG8OJGMOIFGMOGMGJOGIJGP8MGMOGEFJIG57K6JKGJKGKIJGM8ENNGMNNGIMJGENMNLNMENIGMN8NGJMNGNIGMNNGMNNGEJIGMEJ8FGNMNNGIMNGNMNGJMNGIN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6261 4977 4548
Agility 729 145 20
Stamina 7658 6035 5862
Intellect 55 53 20
Spirit 82 82 20
Health 150167 127515 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.59% 9.59% 982
Spell Crit 20.36% 15.36% 2575
Spell Haste 11.23% 5.93% 760
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14215 10354 190
Melee Hit 8.18% 8.18% 982
Melee Crit 23.36% 15.96% 2575
Melee Haste 5.93% 5.93% 760
Expertise 12.69 12.69 381
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.02% 15.02% 1259

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 2
Taste for Blood 3
Sweeping Strikes 1
Impale 2
Improved Hamstring 0
Improved Slam 2
Deadly Calm 1
Blood Frenzy 2
Lambs to the Slaughter 3
Juggernaut 1
Sudden Death 2
Wrecking Crew 2
Throwdown 1
Bladestorm 1
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 0
Rude Interruption 0
Piercing Howl 0
Flurry 0
Death Wish 0
Enrage 0
Die by the Sword 0
Raging Blow 0
Rampage 0
Heroic Fury 0
Furious Attacks 0
Meat Cleaver 0
Intensify Rage 0
Bloodsurge 0
Skirmisher 0
Titan's Grip 0
Single-Minded Fury 0
Protection Rank
Incite 1
Toughness 0
Blood and Thunder 2
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Arms_T11_372
origin="http://chardev.org/?profile=36399"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
glyphs=thunder_clap/cleaving/sweeping_strikes/battle/berserker_rage/intimidating_shout/slam/overpower/mortal_strike
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
actions+=/recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/berserker_rage,if=!buff.deadly_calm.up&rage<70
actions+=/deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
actions+=/sweeping_strikes,if=target.adds>0
actions+=/bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
actions+=/cleave,if=target.adds>0
actions+=/inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
actions+=/heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
actions+=/overpower,if=buff.taste_for_blood.remains<=1.5
actions+=/mortal_strike,if=target.health_pct>20|rage>=30
actions+=/execute,if=buff.battle_trance.up
actions+=/rend,if=!ticking
actions+=/colossus_smash,if=buff.colossus_smash.remains<0.5
actions+=/execute,if=(buff.deadly_calm.up|buff.recklessness.up)
actions+=/mortal_strike
actions+=/overpower
actions+=/execute
actions+=/slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
actions+=/battle_shout,if=rage<20
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4548
# gear_agility=20
# gear_stamina=5862
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=381
# gear_hit_rating=982
# gear_crit_rating=2575
# gear_haste_rating=760
# gear_mastery_rating=1259
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_1h_T11_372 : 27997dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27996.8 18.18 / 0.06% 2215.2 12.6 12.7 rage 8.52% 46.1
Origin http://chardev.org/?profile=36557
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • battle
  • berserker_rage
  • bloody_healing
  • slam
  • raging_blow
  • bloodthirst

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:24752|23420|20971|17122|7270|3791|2355&chds=0,49504&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++24752++execute,C79C6E,0,0,15|t++23420++slam,C79C6E,1,0,15|t++20971++bloodthirst,C79C6E,2,0,15|t++17122++raging_blow,C79C6E,3,0,15|t++7270++colossus_smash,C79C6E,4,0,15|t++3791++melee_main_hand,C79C6E,5,0,15|t++2355++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:34,14,10,8,7,6,6,6,4,4,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|heroic_strike|melee_off_hand|slam_mh|deep_wounds|raging_blow_mh|execute|slam_oh|raging_blow_oh|colossus_smash&chtt=Warrior_Fury_1h_T11_372+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:cpoYafYdmjosqtzwz0y0211uomljinw134568766633yrleeeafhgjlknomprruwrojceebhkknporsqttsuuqohbbaZdfhjlmoqqstuvvtpjedccegiklmnopqrsstrniecccdhjkmnoqrrqnnonkgcZaabeghjklnopqrrsqniecbcegjlnoopqrstttrojfdccdgiklnopqrssttrokfdccdfhjlmnoqrssttrokgdccdfhjlnopqrsttsrokgdccdfhjlmnpqrrstsrplheccdfhjlmnolklmnnmkhebaabceghjklmnooppomjgedcdfgijklmnopqqqpoligeeefgijkmnnopqqqpomjhfffghiklmmnoppqqpomkhgffghhjklmmnoopppomkihggghijklmmnoooooonlkihhhhijihghijkllmmmllkjjjk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Warrior_Fury_1h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:74552331110223100yyyvuutssrqrqpppoomkkihhhggfeeeddcbbaaaZaaZZaZZZZZaZaaZaaZaaZaZZaZZaZZZZZZZZZZZaaabbbbccccdddeeeefffffffeeeeeddddccccccccccddeffgghhiijjkkllllllkkjjihhggffeeddccbbbaaaZZZZZZZZZZZZaaaaaaaabbbccccddddeeeeeeeeeeeeeeeeeeeeefffffgggfffffffeeedddcccbbbbbbcccdddeeeefffffgggggggfffffffffffffffffffgggggggggggggggggggffffffeeeeeeeedddddcccccccbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbccccddddeeeffgghhhhiiiiiiiiihhhhhhhhhhhhhhiiiijjjkkkkkllllllmmmmmnnnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27997|max=52688&chxp=1,1,53,100&chtt=Warrior_Fury_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,6,8,4,8,13,37,41,52,67,61,102,133,177,211,244,269,325,408,409,466,527,541,563,575,528,532,525,467,456,386,334,299,269,196,158,129,123,103,77,37,39,37,17,10,9,7,4,4,4&chds=0,575&chbh=5&chxt=x&chxl=0:|min=24911|avg=27997|max=31193&chxp=0,1,49,100&chtt=Warrior_Fury_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T11_372 27997
battle_shout 0 0.0% 12.2 36.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.23 12.23 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 6.9 55.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.92 6.92 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 9489 33.9% 134.9 3.34sec 31822 20971 23351 48718 106987 33.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.87 134.87 0.00 0.00 1.5174 0.0000 4291731
Direct Results Count Pct Average Min Max Total Damage
hit 89.8 66.61% 23351.12 14404 51936 2097724
crit 45.0 33.39% 48718.03 29672 106987 2194007

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 532 1.9% 21.9 21.10sec 10996 7270 8747 18261 28058 23.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.89 21.89 0.00 0.00 1.5125 0.0000 240664
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 76.36% 8747.41 6477 13621 146198
crit 5.2 23.64% 18260.72 13343 28058 94466

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage by $s1%. Increases all damage taken by $s3%.
  • description:When activated you become Enraged, increasing your physical damage by $s1% but increasing all damage taken by $s3%. Lasts $d.
deep_wounds 1639 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 434 1710 0 0.0% 0.0% 95.9%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 210.06 433.56 433.56 0.0000 1.0000 741336
Direct Results Count Pct Average Min Max Total Damage
hit 210.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 433.6 100.00% 1709.90 302 7279 741336

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1038.82
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1619 5.8% 19.6 4.57sec 37398 24752 30340 62046 133098 22.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.58 19.58 0.00 0.00 1.5109 0.0000 732090
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 77.74% 30340.35 2711 64611 461732
crit 4.4 22.26% 62045.84 14974 133098 270359

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2877 10.3% 55.6 7.97sec 23390 0 15933 32798 69783 44.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.63 55.63 0.00 0.00 0.0000 0.0000 1301266
Direct Results Count Pct Average Min Max Total Damage
hit 31.0 55.79% 15933.38 9399 33875 494542
crit 24.6 44.21% 32798.31 19362 69783 806724

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3786 13.5% 262.0 1.73sec 6537 3791 6751 13898 27413 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.00 262.00 0.00 0.00 1.7244 0.0000 1712591
Direct Results Count Pct Average Min Max Total Damage
hit 96.6 36.85% 6750.79 4409 13307 651831
crit 53.4 20.40% 13897.68 9082 27413 742698
glance 62.8 23.98% 5063.10 3307 9981 318062
miss 49.2 18.77% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2352 8.4% 261.4 1.73sec 4071 2355 4207 8670 17133 20.3% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.35 261.35 0.00 0.00 1.7286 0.0000 1063963
Direct Results Count Pct Average Min Max Total Damage
hit 96.2 36.82% 4206.73 2756 8317 404852
crit 53.2 20.34% 8670.09 5677 17133 460969
glance 62.8 24.02% 3156.21 2067 6238 198141
miss 49.2 18.81% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 2639 9.4% 46.0 9.50sec 25961 17122 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.99 45.99 0.00 0.00 1.5163 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 1620 5.8% 46.0 9.50sec 15938 0 12108 25404 50363 28.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.99 45.99 0.00 0.00 0.0000 0.0000 732897
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 71.20% 12108.15 8185 24448 396427
crit 13.2 28.80% 25403.91 16861 50363 336470

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 1019 3.6% 46.0 9.50sec 10024 0 7598 15974 31477 29.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.99 45.99 0.00 0.00 0.0000 0.0000 460945
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 71.04% 7597.93 5116 15280 248208
crit 13.3 28.96% 15974.24 10538 31477 212737

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
slam 3064 10.9% 39.2 11.27sec 35388 23420 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.16 39.16 0.00 0.00 1.5111 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 39.2 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1843 6.6% 39.2 11.27sec 21285 0 16328 33888 66299 28.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.16 39.16 0.00 0.00 0.0000 0.0000 833442
Direct Results Count Pct Average Min Max Total Damage
hit 28.1 71.77% 16327.99 11199 32184 458857
crit 11.1 28.23% 33887.67 23070 66299 374584

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74
slam_oh 1221 4.4% 39.2 11.27sec 14103 0 10809 22403 43104 28.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.16 39.16 0.00 0.00 0.0000 0.0000 552227
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.59% 10809.46 7430 20924 303010
crit 11.1 28.41% 22402.95 15305 43104 249217

Action details: slam_oh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_1h_T11_372
bloodthirst rage 47.2% 1591.1 20
colossus_smash rage 7.5% 559.4 20
death_wish rage 0.5% 0.0 7
execute rage 9.8% 1302.1 29
heroic_strike rage 19.6% 1163.2 20
raging_blow rage 15.4% 1353.6 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.2 366.9 30.0 0.0%
berserker_rage rage 6.9 58.7 8.5 0.3%
melee_main_hand rage 212.8 3558.8 16.7 1.1%
melee_off_hand rage 212.2 1780.5 8.4 0.7%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 20.2 0.0 21.3sec 21.3sec 8% 8%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 6.9 0.0 55.2sec 55.2sec 15% 15%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.0sec 123.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 39.4 1.1 11.3sec 11.0sec 16% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 14.6 41.9 29.2sec 7.4sec 58% 56%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 18.5 45.6sec 4.6sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 77.7 152.5 5.8sec 2.0sec 70% 69%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 338.2sec 338.2sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.8sec 104.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.2 0.0 40.8sec 40.8sec 10% 16%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 13.5 13.1 33.2sec 16.5sec 50% 51%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.5 46.3sec 32.7sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.6 44.3 368.8sec 9.5sec 96% 95%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.8%

Procs

Count Interval
munched_deep_wounds 48.0 9.7sec
rolled_deep_wounds 35.3 13.1sec

Statistics & Data Analysis

DPS
Population
Convergence 69.43%
σ of the average dps 9.0891
2 * σ / μ 0.0649%
95% Confidence Intervall ( μ ± 2σ ) ( 27978.63 - 28014.99 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27969.54 - 28024.08 )
Sample Data
σ 908.9134
Minimum 24910.94
Maximum 31192.67
Spread ( max - min ) 6281.73
Range ( max - min ) / 2 3140.87
Range% 11.22
10th Percentile 26828.95
90th Percentile 29159.33
( 90th Percentile - 10th Percentile ) 2330.38
Approx. Iterations needed for
1% dps error 42
0.1% dps error 4215
0.1 scale factor error with delta=300 7343
0.05 scale factor error with delta=300 29373
0.01 scale factor error with delta=300 734332
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F slam,if=buff.bloodsurge.react
G execute,if=rage>=50
H berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
I raging_blow
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEIAEFEAIEEAIEFAECAEFAEFEHAIEJAEIEAECAEFAEFEAIEEFEHICEJAEIEAFEFEIEAFECAEHIAEEIEFEAJEAECAEFAEHIAEFAEIAEAEIAECAEFAEIJEFAIE7EIECEIEEIEEIEJAECAEIEFEFEIEFEIECAEFEAIEJEIEFEIECAEIEFEIEAFEIEJAECAEFE6HIEEIEAEAFECAEEFEIEAJEAHIEFAECAEFAEFEE7IEFEAICEJAEIEAEIEFEAIEACEFEHIEEAJEAIEFCAEIAEAEHIAEFAEFEICAEJAEFAEIEFEIEAECAEIEEAIEFJAEFAEIACEAIEAEHIEAEIECAEIEFEF7EFAEFABDDDDJCEGEIEFBEGEGEFCAEBEFGEAF6EAGEGEGCEGEIEAJBEGEGEGCEAFEABEFEGEGGEGCEGIEFEBEF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6222 4940 4513
Agility 729 145 20
Stamina 7572 5953 5780
Intellect 55 53 20
Spirit 82 82 20
Health 148963 126367 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 6.10% 6.10% 625
Spell Crit 20.20% 15.20% 2545
Spell Haste 13.93% 8.50% 1089
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14130 10280 190
Melee Hit 8.20% 8.20% 625
Melee Crit 23.19% 15.79% 2545
Melee Haste 8.50% 8.50% 1089
Expertise 26.64 26.64 800
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.51% 12.51% 809

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 0
Single-Minded Fury 1
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_1h_T11_372
origin="http://chardev.org/?profile=36557"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
glyphs=death_wish/cleaving/heroic_throw/battle/berserker_rage/bloody_healing/slam/raging_blow/bloodthirst
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands=plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4513
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=800
# gear_hit_rating=625
# gear_crit_rating=2545
# gear_haste_rating=1089
# gear_mastery_rating=809
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_2h_T11_372 : 27839dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27839.3 18.79 / 0.07% 2190.6 12.7 12.8 rage 8.49% 46.3
Origin http://chardev.org/?profile=36611
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • bloody_healing
  • battle
  • berserker_rage
  • bloodthirst
  • raging_blow
  • slam

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27052|21523|18560|17730|9817|3665|2272&chds=0,54104&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++27052++raging_blow,C79C6E,0,0,15|t++21523++execute,C79C6E,1,0,15|t++18560++bloodthirst,C79C6E,2,0,15|t++17730++slam,C79C6E,3,0,15|t++9817++colossus_smash,C79C6E,4,0,15|t++3665++melee_main_hand,C79C6E,5,0,15|t++2272++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:30,13,12,9,8,7,7,7,4,3&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|raging_blow_mh|heroic_strike|melee_off_hand|deep_wounds|raging_blow_oh|slam_mh|execute|colossus_smash&chtt=Warrior_Fury_2h_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:foqcdaYcojmkkpyuvsrx10ytmkcffow1vy1675zz134xskccZbghiijkmommoorsnlgYaaahkjllmpqqrqprrpmfZYXYdgghijmooppqssqmgcaZbehijjkmoooppqqplgcZZbehjjklnpppnkklkhdZXXYbeffghjlmmmnoonkgbYYadgijklnoooopqqplhdbacegijklmnopppqpolhdbabdfhijkmnoppqqqolhdbabdfhijkmnooppppnkhdbabdfhijklnopppppolhebabdfhijklmkiijjkjhebZYZacdefghijkklllkifdbbbdfghijklmnnooonligeddefgijklmmnooooomkhfeeefhijklmnooppoomkhgeeefghijklmnooooonljhgffghijkkmmnoopponmkjihhhhiiihghijkllmmlkjihhhi&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=71&chtt=Warrior_Fury_2h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:7453112010z1110yzxwwussrrqqoponnmmmlijhgggffeeedccbbbaaaZZZYZZYZZYZZYZZYZZYZZYZZYZZZZZZZZZZYYZZZZZZZZaaaaabbbbccccdddddddddddccccccbbbbbbbbcccdeeffgghhiijjkkkkkkkkjjiihggffeeddccbbaaaZZYYZZZZYYZZZYYZZZZZZZaaaaabbbbbbccccccccddccccddddeeeeeffffffffffeeeeddcccbbaaaaaaaabbbbccccddddeeefffffffffffffffffffffffffffffffeeeeeeeeeeeeddddddddddccccccccccbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbcccddeeeeffffffffffffffeeeeeeeeeeefffggghhiiijjjkkklllmmmmnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27839|max=54439&chxp=1,1,51,100&chtt=Warrior_Fury_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,2,5,3,7,10,19,33,53,41,64,99,129,198,231,246,311,402,422,544,553,589,619,640,630,588,550,516,520,386,340,303,254,173,156,95,77,69,57,19,11,10,9,6,0,6,1,0,2&chds=0,640&chbh=5&chxt=x&chxl=0:|min=24217|avg=27839|max=31580&chxp=0,1,49,100&chtt=Warrior_Fury_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T11_372 27839
battle_shout 0 0.0% 12.1 37.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.07 12.07 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.1 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 9.5 44.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.53 9.53 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.5 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 8235 29.6% 132.3 3.41sec 28157 18560 20534 42858 94424 34.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.27 132.27 0.00 0.00 1.5171 0.0000 3724455
Direct Results Count Pct Average Min Max Total Damage
hit 87.1 65.85% 20534.31 12557 45837 1788670
crit 45.2 34.15% 42857.63 25867 94424 1935785

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 719 2.6% 21.9 21.10sec 14856 9817 11734 24457 36866 24.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.88 21.88 0.00 0.00 1.5133 0.0000 325011
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 75.46% 11734.38 8692 17896 193722
crit 5.4 24.54% 24456.90 18004 36866 131290

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage by $s1%. Increases all damage taken by $s3%.
  • description:When activated you become Enraged, increasing your physical damage by $s1% but increasing all damage taken by $s3%. Lasts $d.
deep_wounds 2048 7.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 423 2190 0 0.0% 0.0% 93.5%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 183.43 422.94 422.94 0.0000 1.0000 926304
Direct Results Count Pct Average Min Max Total Damage
hit 183.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 422.9 100.00% 2190.17 422 10898 926304

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1974.84
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1184 4.3% 16.5 5.46sec 32498 21523 26210 53724 115844 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.48 16.48 0.00 0.00 1.5099 0.0000 535496
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 77.15% 26210.36 724 62644 333178
crit 3.8 22.85% 53723.57 9184 115844 202318

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2492 9.0% 54.7 8.11sec 20603 0 13903 28698 61587 45.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.70 54.70 0.00 0.00 0.0000 0.0000 1126932
Direct Results Count Pct Average Min Max Total Damage
hit 29.9 54.71% 13902.68 8276 29897 416063
crit 24.8 45.29% 28698.36 17217 61587 710870

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3658 13.1% 176.8 2.57sec 9358 3665 9426 19412 37734 21.3% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.80 176.80 0.00 0.00 2.5533 0.0000 1654376
Direct Results Count Pct Average Min Max Total Damage
hit 66.3 37.49% 9426.28 6171 18317 624861
crit 37.6 21.27% 19411.89 12712 37734 729807
glance 42.4 23.98% 7070.49 4628 13738 299708
miss 30.5 17.26% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2268 8.1% 176.1 2.57sec 5822 2272 5876 12101 23583 21.1% 17.3% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.14 176.14 0.00 0.00 2.5629 0.0000 1025549
Direct Results Count Pct Average Min Max Total Damage
hit 66.1 37.51% 5875.90 3857 11448 388219
crit 37.2 21.14% 12100.61 7993 23583 450479
glance 42.4 24.07% 4407.11 2893 8586 186851
miss 30.4 17.28% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 5306 19.1% 58.5 7.72sec 41038 27052 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.47 58.47 0.00 0.00 1.5170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 58.5 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 3259 11.7% 58.5 7.72sec 25205 0 18989 39814 75404 29.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.47 58.47 0.00 0.00 0.0000 0.0000 1473826
Direct Results Count Pct Average Min Max Total Damage
hit 41.0 70.15% 18989.40 12579 36604 778924
crit 17.5 29.85% 39813.78 25913 75404 694902

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 2047 7.4% 58.5 7.72sec 15833 0 11928 25059 47127 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.47 58.47 0.00 0.00 0.0000 0.0000 925781
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.26% 11927.87 7862 22877 490055
crit 17.4 29.74% 25059.26 16471 47127 435725

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
slam 1930 6.9% 32.6 13.52sec 26776 17730 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.61 32.61 0.00 0.00 1.5102 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 32.6 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1930 6.9% 32.6 13.52sec 26776 0 20490 42276 85658 28.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.61 32.61 0.00 0.00 0.0000 0.0000 873035
Direct Results Count Pct Average Min Max Total Damage
hit 23.2 71.15% 20490.11 14684 41582 475321
crit 9.4 28.85% 42276.26 30090 85658 397714

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_2h_T11_372
bloodthirst rage 46.0% 1407.9 20
colossus_smash rage 7.5% 756.3 20
death_wish rage 0.5% 0.0 7
execute rage 8.1% 1155.6 28
heroic_strike rage 18.5% 1062.1 19
raging_blow rage 19.5% 2139.1 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.1 362.2 30.0 0.0%
berserker_rage rage 9.5 90.9 9.5 0.9%
melee_main_hand rage 146.3 3555.4 24.3 1.6%
melee_off_hand rage 145.7 1789.8 12.3 0.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 19.9 0.0 21.6sec 21.6sec 8% 9%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 9.5 0.0 44.7sec 44.7sec 21% 21%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.2sec 123.2sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 33.4 6.2 13.3sec 11.2sec 27% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 15.1 30.5 28.1sec 9.1sec 52% 51%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 15.4 46.3sec 5.5sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 49.3 145.1 9.2sec 2.3sec 78% 76%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.1sec 339.1sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 105.9sec 105.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.3 0.0 40.7sec 40.7sec 10% 17%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 14.4 20.7 31.4sec 12.6sec 61% 62%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.5 3.5 46.0sec 32.6sec 29% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 57.5 391.3sec 7.7sec 99% 98%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.9%

Procs

Count Interval
munched_deep_wounds 34.4 13.4sec
rolled_deep_wounds 31.1 14.8sec

Statistics & Data Analysis

DPS
Population
Convergence 70.24%
σ of the average dps 9.3973
2 * σ / μ 0.0675%
95% Confidence Intervall ( μ ± 2σ ) ( 27820.55 - 27858.14 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27811.15 - 27867.54 )
Sample Data
σ 939.7345
Minimum 24217.11
Maximum 31580.22
Spread ( max - min ) 7363.11
Range ( max - min ) / 2 3681.55
Range% 13.22
10th Percentile 26638.64
90th Percentile 29041.37
( 90th Percentile - 10th Percentile ) 2402.72
Approx. Iterations needed for
1% dps error 45
0.1% dps error 4557
0.1 scale factor error with delta=300 7849
0.05 scale factor error with delta=300 31399
0.01 scale factor error with delta=300 784978
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
G raging_blow
H slam,if=buff.bloodsurge.react
I execute,if=rage>=50
J battle_shout,if=rage<70

Sample Sequence

0134567JCEGEEGEAEGEEACEGEJAEFGEHEAGEHCAEGEEAGEHEAFGEHECAEGJEEGEEAGEACEAFGEAEGEAEGEJECAGEEGEEGEAEGACEAHEFGEHEGAEJ7AEGECEGEEGEAHEAGCEHEAFGEJEGEAHEGAECEGEHEFGEAEGEHAECAEJAEHEEFGEEGEACEAG6EGJEFAGEAHCAEGAEHEAGEEGEHCJEFGEHEGE7HEGECAEGEEAGEAJEAGEECAEFGAEHAEGEHEHECAEHAEJEFGEHEAGEHECEAGEHEGEAEGEAJCAEFGAEHEAGEHEAEAHECAEHEFGEHEGEHJAEGCEAEGEE7GEEBDCDDJDEGEHBEGCBEFGEIEGEHBE6GEACBEGHEBGEHEBEGCEBEGJEBFHEGHBECAEGBEIEGEIEGEH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6519 5223 4782
Agility 729 145 20
Stamina 8265 6613 6440
Intellect 55 53 20
Spirit 82 82 20
Health 158665 135607 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 7.87% 7.87% 806
Spell Crit 21.01% 16.01% 2691
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14783 10845 190
Melee Hit 9.71% 9.71% 806
Melee Crit 24.00% 16.61% 2691
Melee Haste 5.13% 5.13% 657
Expertise 26.01 26.01 781
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.51% 16.51% 1526

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 1
Single-Minded Fury 0
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_2h_T11_372
origin="http://chardev.org/?profile=36611"
level=85
race=worgen
role=attack
use_pre_potion=1
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
glyphs=death_wish/cleaving/heroic_throw/bloody_healing/battle/berserker_rage/bloodthirst/raging_blow/slam
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4782
# gear_agility=20
# gear_stamina=6440
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=806
# gear_crit_rating=2691
# gear_haste_rating=657
# gear_mastery_rating=1526
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket1=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Auras/Buffs

Constant Buff
abominations_might
arcane_tactics
battle_shout
communion
demonic_Pact
devotion_aura
elemental_oath
fel_intelligence
ferocious_inspiration
flametongue_totem
honor_among_thieves
horn_of_winter
hunting_party
improved_icy_talons
leader_of_the_pack
mana_spring_totem
mind_quickening
moonkin
qiraji_fortitude
rampage
roar_of_courage
strength_of_earth
trueshot
unleashed_rage
windfury_totem
wrath_of_air

Fluffy_Pillow : 0dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
0.0 0.00 / 0.00% 0.0 854278.5 0.0 health 100.02% 0.0

Charts

http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t8777776666555544443333332222211111110000000zzzzzzzyyyyyyyyxxxxxxxwwwwwwwwvvvvvvvvuuuuuuuuuttttttttsssssssssrrrrrrrrqqqqqqqqpppppppoooooooonnnnnnnnmmmmmmmmllllllllkkkkkkkkjjjjjjjjjiiiiiiiiihhhhhhhggggggggffffffffeeeeeeeeddddddddccccccccbbbbbbbbaaaaaaaaZZZZZZZYYYYYYYYXXXXXXXXXWWWWWWWWVVVVVVVVUUUUUUUUTTTTTTTTSSSSSSSSSRRRRRRRRQQQQQQQPPPPPPPPOOOOOOOONNNNNNNNMMMMMMMMMMMMLLLLLLLLLLLLLLKKKKKKKKKKKKKKKJJJJJJJJJJJJJJIIIIIIIIIIIIIIIHHHHHHHHHHHHHHHGGGGGGGGGGG&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=385726644&chtt=Fluffy_Pillow+Health+Timeline&chts=dddddd,18&chco=336600 http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=0|max=0&chxp=1,1,-nan,100&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18

Abilities

Resources

Resource Usage Type Res% DPR RPE
Fluffy_Pillow
Resource Gains Type Count health Average Overflow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs
bleeding

Database details

  • id:
  • cooldown name:buff_bleeding
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_bleed

Database details

  • id:
  • cooldown name:buff_blood_frenzy_bleed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_physical

Database details

  • id:
  • cooldown name:buff_blood_frenzy_physical
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
brittle_bones

Database details

  • id:
  • cooldown name:buff_brittle_bones
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
corrosive_spit

Database details

  • id:95466
  • cooldown name:buff_corrosive_spit
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
critical_mass

Database details

  • id:22959
  • cooldown name:buff_critical_mass
  • tooltip:Spells have a $s1% additional chance to critically hit.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
curse_of_elements

Database details

  • id:
  • cooldown name:buff_curse_of_elements
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_roar

Database details

  • id:99
  • cooldown name:buff_demoralizing_roar
  • tooltip:Reduces physical damage caused by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_screech

Database details

  • id:24423
  • cooldown name:buff_demoralizing_screech
  • tooltip:Physical damage reduced by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
demoralizing_shout

Database details

  • id:
  • cooldown name:buff_demoralizing_shout
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
earth_and_moon

Database details

  • id:60433
  • cooldown name:buff_earth_and_moon
  • tooltip:Increases spell damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
ebon_plague

Database details

  • id:
  • cooldown name:buff_ebon_plague
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
expose_armor

Database details

  • id:
  • cooldown name:buff_expose_armor
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
faerie_fire

Database details

  • id:91565
  • cooldown name:buff_faerie_fire
  • tooltip:Armor reduced by $s1%. Cannot stealth or turn invisible.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
hemorrhage

Database details

  • id:
  • cooldown name:buff_hemorrhage
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
hunters_mark

Database details

  • id:1130
  • cooldown name:buff_hunters_mark
  • tooltip:All attackers gain $s2 ranged attack power against this target.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
infected_wounds

Database details

  • id:
  • cooldown name:buff_infected_wounds
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_just

Database details

  • id:
  • cooldown name:buff_judgements_of_the_just
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_breath

Database details

  • id:24844
  • cooldown name:buff_lightning_breath
  • tooltip:Increases magic damage taken by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
mangle

Database details

  • id:
  • cooldown name:buff_mangle
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
master_poisoner

Database details

  • id:
  • cooldown name:buff_master_poisoner
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
poisoned

Database details

  • id:
  • cooldown name:buff_poisoned
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ravage

Database details

  • id:50518
  • cooldown name:buff_ravage
  • tooltip:Increases physical damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
savage_combat

Database details

  • id:
  • cooldown name:buff_savage_combat
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
scarlet_fever

Database details

  • id:
  • cooldown name:buff_scarlet_fever
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_and_flame

Database details

  • id:17800
  • cooldown name:buff_shadow_and_flame
  • tooltip:Chance to be critically hit with spells increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sunder_armor

Database details

  • id:58567
  • cooldown name:buff_sunder_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
tailspin

Database details

  • id:90315
  • cooldown name:buff_tailspin
  • tooltip:Melee and ranged attack speed reduced by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tear_armor

Database details

  • id:95467
  • cooldown name:buff_tear_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
tendon_rip

Database details

  • id:50271
  • cooldown name:buff_tendon_rip
  • tooltip:All bleed effects cause $s1% additional damage.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
thunder_clap

Database details

  • id:
  • cooldown name:buff_thunder_clap
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vindication

Database details

  • id:
  • cooldown name:buff_vindication
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 0.00%
σ of the average dps 0.0000
2 * σ / μ 0.0000%
95% Confidence Intervall ( μ ± 2σ ) ( 0.00 - 0.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 0.00% - 0.00% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 0.00 - 0.00 )
Sample Data
σ 0.0000
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range ( max - min ) / 2 0.00
Range% 0.00
10th Percentile 0.00
90th Percentile 0.00
( 90th Percentile - 10th Percentile ) 0.00
Approx. Iterations needed for
1% dps error 0
0.1% dps error 0
0.1 scale factor error with delta=300 0
0.05 scale factor error with delta=300 0
0.01 scale factor error with delta=300 0
DPS Timeline Chart

Action Priority List

# action,conditions
0 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 461605718 0
Mana 0 0 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Expertise 0.00 0.00 0
Armor 10540 11977 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 8.00% 8.00% 0

Gear

Encoded
head empty
neck empty
shoulders empty
shirt empty
chest empty
waist empty
legs empty
feet empty
wrists empty
hands empty
finger1 empty
finger2 empty
trinket1 empty
trinket2 empty
back empty
main_hand empty
off_hand empty
ranged empty
tabard empty

Talents

Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Improved Cower 0
Bloodthirsty 0
Spiked Collar 0
Boar's Speed 0
Culling the Herd 0
Lionhearted 0
Swoop 0
Charge 0
Heart of the Phoenix 0
Spider's Bite 0
Great Resistance 0
Rabid 0
Lick Your Wounds 0
Call of the Wild 0
Shark Attack 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Charge 0
Great Stamina 0
Natural Armor 0
Spiked Collar 0
Boar's Speed 0
Blood of the Rhino 0
Pet Barding 0
Culling the Herd 0
Guard Dog 0
Lionhearted 0
Thunderstomp 0
Grace of the Mantis 0
Great Resistance 0
Last Stand 0
Taunt 0
Roar of Sacrifice 0
Intervene 0
Silverback 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Boar's Speed 0
Mobility 0
Mobility 0
Owl's Focus 0
Spiked Collar 0
Culling the Herd 0
Lionhearted 0
Carrion Feeder 0
Great Resistance 0
Cornered 0
Feeding Frenzy 0
Wolverine Bite 0
Roar of Recovery 0
Bullheaded 0
Grace of the Mantis 0
Wild Hunt 0
Roar of Sacrifice 0

Profile

#!./simc

enemy=Fluffy_Pillow
origin="unknown"
level=88
race=humanoid
role=tank
use_pre_potion=1
talents=http://www.wowhead.com/talent#enemy-000000000000000000000000000000000000000000000000000000000000000
actions=snapshot_stats
# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per second.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

( 2 * dps_stddev / sqrt( iterations ) ) / dps_avg

Convergence

Rate at which multipling iterations by convergence_scale reduces error

For default convergence_scale=2 it should itself approach 70.71% according to the central limit theorem

G%

Percentage of executes that resulted in glancing blows.

G%

Percentage of executes that resulted in blocking blows.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Max

Maximum crit damage over all iterations.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps_max - dps_min ) / ( 2 * dps_avg )

RPS In

Average resource points generated per second.

RPS Out

Average resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.